• Gene id: 5031

Gene Summary

• Gene Symbol: P2RY6   Gene   UCSC   Ensembl
• Aliases: P2Y6
• Gene name: pyrimidinergic receptor P2Y6
• Alternate names: P2Y purinoceptor 6, G-coupled nucleotide receptor, P2 purinoceptor, P2Y6 receptor, pyrimidinergic receptor P2Y, G-protein coupled, 6,
• Gene location: 11q13.4 (73264502: 73298624)     Exons: 7     NC_000011.10
• Gene summary(Entrez): The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different
• OMIM: 606251

Protein Summary

• Protein general information: Q15077  
  • Name: P2Y purinoceptor 6 (P2Y6)
  • Length: 328  
  • Mass: 36429
• Sequence:

  MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLY
  ACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVA
  VWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGP
  AEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
  FYFTQKKFRRRPHELLQKLTAKWQRQGR

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001973  
  • Prosite: PS50262
  • PDB: 2B6R
  • PDBsum: 2B6R
  • STRING: ENSP00000480966
• Other Databases: GeneCards:  P2RY6  Malacards:  P2RY6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001621	G protein-coupled ADP receptor activity	IDA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IC	biological process
GO:1905835	cellular response to pyrimidine ribonucleotide	IDA	biological process
GO:0005886	plasma membrane	IC	cellular component
GO:0045030	G protein-coupled UTP receptor activity	IDA	molecular function
GO:0045029	G protein-coupled UDP receptor activity	IDA	molecular function
GO:0006909	phagocytosis	ISS	biological process
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0071415	cellular response to purine-containing compound	IDA	biological process
GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	IDA	biological process
GO:1905835	cellular response to pyrimidine ribonucleotide	ISS	biological process
GO:0031587	positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity	ISS	biological process
GO:0031587	positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity	TAS	biological process
GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	TAS	biological process
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0031587	positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity	IEA	biological process
GO:0030321	transepithelial chloride transport	IEA	biological process
GO:0045029	G protein-coupled UDP receptor activity	IEA	molecular function
GO:0071380	cellular response to prostaglandin E stimulus	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:1905835	cellular response to pyrimidine ribonucleotide	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq