• Gene id: 5029

Gene Summary

• Gene Symbol: P2RY2   Gene   UCSC   Ensembl
• Aliases: HP2U, P2RU1, P2U, P2U1, P2UR, P2Y2, P2Y2R
• Gene name: purinergic receptor P2Y2
• Alternate names: P2Y purinoceptor 2, ATP receptor, P2U nucleotide receptor, P2U purinoceptor 1, P2U receptor 1, purinergic receptor P2Y, G-protein coupled, 2, purinoceptor P2Y2,
• Gene location: 11q13.4 (73200415: 73246742)     Exons: 12     NC_000011.10
• Gene summary(Entrez): The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different
• OMIM: 602451

Protein Summary

• Protein general information: P41231  
  • Name: P2Y purinoceptor 2 (P2Y2) (ATP receptor) (P2U purinoceptor 1) (P2U1) (P2U receptor 1) (Purinergic receptor)
  • Length: 377  
  • Mass: 42273
  • Tissue specificity: Spleen, testis, kidney, liver, lung, heart and brain.
• Sequence:

  MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLCRLKTWNASTTYMFHL
  AVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLRSLRWGRARYA
  RRVAGAVWVLVLACQAPVLYFVTTSARGGRVTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRL
  LKPAYGTSGGLPRAKRKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
  LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSRRTESTPAGSENTKDI
  RL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000356  
  • Prosite: PS00237 PS50262
  • PDB: 1Z8E
  • PDBsum: 1Z8E
  • STRING: ENSP00000310305
• Other Databases: GeneCards:  P2RY2  Malacards:  P2RY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071318	cellular response to ATP	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0070257	positive regulation of mucus secretion	IEA	biological process
GO:0097746	regulation of blood vessel diameter	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006873	cellular ion homeostasis	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04750	Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq