• Gene id: 5028

Gene Summary

• Gene Symbol: P2RY1   Gene   UCSC   Ensembl
• Aliases: P2Y1, SARCC
• Gene name: purinergic receptor P2Y1
• Alternate names: P2Y purinoceptor 1, ADP receptor, ATP receptor, P2 purinoceptor subtype Y1, platelet ADP receptor, purinergic receptor P2Y, G-protein coupled, 1, suppressing androgen receptor in renal cell carcinoma,
• Gene location: 3q25.2 (152835130: 152841438)     Exons: 1     NC_000003.12
• Gene summary(Entrez): The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor
• OMIM: 610210

SNPs

rs718772

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30108218A>C
NC_000022.11   g.30108218A>G
NC_000022.10   g.30504207A>C
NC_000022.10   g.30504207A>G|SEQ=[A/C/G]|GENE=HORMAD2

rs8135823

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30126470T>G
NC_000022.10   g.30522459T>G|SEQ=[T/G]|GENE=HORMAD2

rs11090601

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30171741A>C
NC_000022.10   g.30567730A>C|SEQ=[A/C]|GENE=HORMAD2

rs4823073

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30116269G>A
NC_000022.10   g.30512258G>A|SEQ=[G/A]|GENE=HORMAD2

rs9620953

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30150256C>T
NC_000022.10   g.30546245C>T|SEQ=[C/T]|GENE=HORMAD2

rs9625930

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30152633G>A
NC_000022.10   g.30548622G>A|SEQ=[G/A]|GENE=HORMAD2

rs975704

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.30176747G>A
NC_000022.10   g.30572736G>A
NM_152510.3   c.*580G>A
NM_152510.4   c.*580G>A
NM_152510.2   c.*580G>A
XM_011529917.3   c.*580G>A
NM_001329457.1   c.*580G>A
NM_001329457.2   c.*580G>A
NM_001329458.1   c.*580G>A
NM_001329458.2   c.*580G>A|SEQ=[

Protein Summary

• Protein general information: P47900  
  • Name: P2Y purinoceptor 1 (P2Y1) (ADP receptor) (Purinergic receptor)
  • Length: 373  
  • Mass: 42072
• Sequence:

  MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWM
  FVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRY
  SGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAM
  FCVPLVLILGCYGLIVRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
  RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000142  
  • Prosite: PS00237 PS50262
  • PDB: 1Y36 4XNV 4XNW
  • PDBsum: 1Y36 4XNV 4XNW
  • STRING: ENSP00000304767
• Other Databases: GeneCards:  P2RY1  Malacards:  P2RY1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071318	cellular response to ATP	TAS	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008360	regulation of cell shape	IMP	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IMP	biological process
GO:0071415	cellular response to purine-containing compound	IMP	biological process
GO:0001621	G protein-coupled ADP receptor activity	IMP	molecular function
GO:0005524	ATP binding	IMP	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0090075	relaxation of muscle	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005929	cilium	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043270	positive regulation of ion transport	IEA	biological process
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0097746	regulation of blood vessel diameter	IEA	biological process
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0051100	negative regulation of binding	IEA	biological process
GO:0046887	positive regulation of hormone secretion	IEA	biological process
GO:0045031	G protein-coupled ATP receptor activity	IEA	molecular function
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0042755	eating behavior	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0023019	signal transduction involved in regulation of gene expression	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0010700	negative regulation of norepinephrine secretion	IEA	biological process
GO:0010469	regulation of signaling receptor activity	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0008347	glial cell migration	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0099509	regulation of presynaptic cytosolic calcium ion concentration	IEA	biological process
GO:0099059	integral component of presynaptic active zone membrane	IEA	cellular component
GO:0097110	scaffold protein binding	IEA	molecular function
GO:0070848	response to growth factor	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060406	positive regulation of penile erection	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043531	ADP binding	IEA	molecular function
GO:0032962	positive regulation of inositol trisphosphate biosynthetic process	IEA	biological process
GO:0031686	A1 adenosine receptor binding	IEA	molecular function
GO:0019233	sensory perception of pain	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0001973	G protein-coupled adenosine receptor signaling pathway	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001621	G protein-coupled ADP receptor activity	IEA	molecular function
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	ISS	molecular function
GO:0045031	G protein-coupled ATP receptor activity	ISS	molecular function
GO:0097110	scaffold protein binding	ISS	molecular function
GO:0023019	signal transduction involved in regulation of gene expression	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0072659	protein localization to plasma membrane	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0045211	postsynaptic membrane	ISS	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04015	Rap1 signaling pathway
hsa04611	Platelet activation
hsa04742	Taste transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881