• Gene id: 5026

Gene Summary

• Gene Symbol: P2RX5   Gene   UCSC   Ensembl
• Aliases: LRH-1, P2X5, P2X5R
• Gene name: purinergic receptor P2X 5
• Alternate names: P2X purinoceptor 5, ATP receptor subunit, ionotropic ATP receptor P2X5, lymphoid-restricted histocompatibility antigen-1, purinergic receptor P2X, ligand gated ion channel, 5,
• Gene location: 17p13.2 (3696154: 3673226)     Exons: 12     NC_000017.11
• Gene summary(Entrez): The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the
• OMIM: 614539

Protein Summary

• Protein general information: Q93086  
  • Name: P2X purinoceptor 5 (P2X5) (ATP receptor) (Purinergic receptor)
  • Length: 422  
  • Mass: 47205
  • Tissue specificity: Expressed at high levels in brain and immune system.
• Sequence:

  MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAF
  TNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTG
  RCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPK
  NHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY
  YRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSE
  QLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRST

• Structural information:
  • Interpro: IPR003048  IPR027309  IPR001429  
  • Prosite: PS01212
  • STRING: ENSP00000225328
• Other Databases: GeneCards:  P2RX5  Malacards:  P2RX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004931	extracellularly ATP-gated cation channel activity	IBA	molecular function
GO:0005639	integral component of nuclear inner membrane	IBA	cellular component
GO:0001614	purinergic nucleotide receptor activity	IEA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033198	response to ATP	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005216	ion channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0001614	purinergic nucleotide receptor activity	NAS	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	NAS	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0010524	positive regulation of calcium ion transport into cytosol	NAS	biological process
GO:0050850	positive regulation of calcium-mediated signaling	NAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq