• Gene id: 5025

Gene Summary

• Gene Symbol: P2RX4   Gene   UCSC   Ensembl
• Aliases: P2X4, P2X4R
• Gene name: purinergic receptor P2X 4
• Alternate names: P2X purinoceptor 4, ATP receptor, ATP-gated cation channel protein, P2X receptor, subunit 4, purinergic receptor P2X, ligand gated ion channel, 4, purinergic receptor P2X4, purinoceptor P2X4,
• Gene location: 12q24.31 (121210095: 121234105)     Exons: 14     NC_000012.12
• Gene summary(Entrez): The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relat
• OMIM: 601090

Protein Summary

• Protein general information: Q99571  
  • Name: P2X purinoceptor 4 (P2X4) (ATP receptor) (Purinergic receptor)
  • Length: 388  
  • Mass: 43369
• Sequence:

  MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTN
  TSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCV
  AFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDP
  FCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYY
  RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYV
  EDYEQGLASELDQ

• Structural information:
  • Interpro: IPR003047  IPR027309  IPR001429  
  • Prosite: PS01212
  • STRING: ENSP00000353032
• Other Databases: GeneCards:  P2RX4  Malacards:  P2RX4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099604	ligand-gated calcium channel activity	ISS	molecular function
GO:0002931	response to ischemia	ISS	biological process
GO:1900027	regulation of ruffle assembly	ISS	NOT|biological process
GO:1904141	positive regulation of microglial cell migration	ISS	biological process
GO:0044297	cell body	ISS	cellular component
GO:1904124	microglial cell migration	TAS	biological process
GO:0048678	response to axon injury	ISS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0019233	sensory perception of pain	ISS	biological process
GO:0019722	calcium-mediated signaling	TAS	biological process
GO:0048266	behavioral response to pain	ISS	biological process
GO:0050920	regulation of chemotaxis	ISS	biological process
GO:0050975	sensory perception of touch	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:0005639	integral component of nuclear inner membrane	IBA	cellular component
GO:0004931	extracellularly ATP-gated cation channel activity	IBA	molecular function
GO:0071318	cellular response to ATP	IDA	biological process
GO:0004931	extracellularly ATP-gated cation channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0034220	ion transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0071294	cellular response to zinc ion	ISS	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0001614	purinergic nucleotide receptor activity	IEA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033198	response to ATP	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099604	ligand-gated calcium channel activity	IEA	molecular function
GO:0071294	cellular response to zinc ion	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0050975	sensory perception of touch	IEA	biological process
GO:0050920	regulation of chemotaxis	IEA	biological process
GO:0048266	behavioral response to pain	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0019233	sensory perception of pain	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008144	drug binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:1904141	positive regulation of microglial cell migration	IEA	biological process
GO:0071318	cellular response to ATP	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0043195	terminal bouton	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0019228	neuronal action potential	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0002028	regulation of sodium ion transport	IEA	biological process
GO:0001614	purinergic nucleotide receptor activity	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0001614	purinergic nucleotide receptor activity	IDA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IDA	molecular function
GO:0001614	purinergic nucleotide receptor activity	IMP	molecular function
GO:0005507	copper ion binding	ISS	molecular function
GO:0008270	zinc ion binding	ISS	molecular function
GO:0045296	cadherin binding	IPI	molecular function
GO:0005524	ATP binding	IC	molecular function
GO:0099604	ligand-gated calcium channel activity	IDA	molecular function
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0007165	signal transduction	IDA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IDA	biological process
GO:0030054	cell junction	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050850	positive regulation of calcium-mediated signaling	IDA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0033198	response to ATP	IDA	biological process
GO:0034405	response to fluid shear stress	IDA	biological process
GO:0051899	membrane depolarization	IDA	biological process
GO:0002028	regulation of sodium ion transport	ISS	biological process
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0008217	regulation of blood pressure	IMP	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IMP	biological process
GO:0032308	positive regulation of prostaglandin secretion	NAS	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IMP	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IMP	biological process
GO:0051928	positive regulation of calcium ion transport	NAS	biological process
GO:0055117	regulation of cardiac muscle contraction	IMP	biological process
GO:0055117	regulation of cardiac muscle contraction	IMP	biological process
GO:0001894	tissue homeostasis	NAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0010614	negative regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0042118	endothelial cell activation	TAS	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	NAS	biological process
GO:0055119	relaxation of cardiac muscle	IMP	biological process
GO:0055119	relaxation of cardiac muscle	IMP	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:2001028	positive regulation of endothelial cell chemotaxis	IMP	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881