• Gene id: 5024

Gene Summary

• Gene Symbol: P2RX3   Gene   UCSC   Ensembl
• Aliases: P2X3
• Gene name: purinergic receptor P2X 3
• Alternate names: P2X purinoceptor 3, ATP receptor, P2X receptor, subunit 3, purinergic receptor P2X, ligand gated ion channel, 3, purinergic receptor P2X3, purinoceptor P2X3,
• Gene location: 11q12.1 (57335942: 57372398)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the P2X purinergic receptor (purinoceptor) gene family which includes seven members (P2RX1 - P2RX7). P2X purinoceptors are a family of cation-permeable, ligand-gated ion channels that open in response to the binding of extrac
• OMIM: 600041

Protein Summary

• Protein general information: P56373  
  • Name: P2X purinoceptor 3 (P2X3) (ATP receptor) (Purinergic receptor)
  • Length: 397  
  • Mass: 44289
• Sequence:

  MNCISDFFTYETTKSVVVKSWTIGIINRVVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGSGLYANRVM
  DVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVLRTCEIQ
  GWCPTEVDTVETPIMMEAENFTIFIKNSIRFPLFNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFA
  GQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDSVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
  FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADQYKAKKFEEVNETTLKIAALTNPV
  YPSDQTTAEKQSTDSGAFSIGH

• Structural information:
  • Interpro: IPR003046  IPR027309  IPR001429  
  • Prosite: PS01212
  • PDB: 5SVJ 5SVK 5SVL 5SVM 5SVP 5SVQ 5SVR 5SVS 5SVT 5YVE 6AH4 6AH5
  • PDBsum: 5SVJ 5SVK 5SVL 5SVM 5SVP 5SVQ 5SVR 5SVS 5SVT 5YVE 6AH4 6AH5
  • STRING: ENSP00000263314
• Other Databases: GeneCards:  P2RX3  Malacards:  P2RX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004931	extracellularly ATP-gated cation channel activity	IBA	molecular function
GO:0005639	integral component of nuclear inner membrane	IBA	cellular component
GO:0015672	monovalent inorganic cation transport	IDA	biological process
GO:0070207	protein homotrimerization	IDA	biological process
GO:0071318	cellular response to ATP	IDA	biological process
GO:0001614	purinergic nucleotide receptor activity	IDA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0001614	purinergic nucleotide receptor activity	IEA	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0033198	response to ATP	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004931	extracellularly ATP-gated cation channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0061368	behavioral response to formalin induced pain	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0098686	hippocampal mossy fiber to CA3 synapse	IEA	cellular component
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0048266	behavioral response to pain	IEA	biological process
GO:0033198	response to ATP	IEA	biological process
GO:0014832	urinary bladder smooth muscle contraction	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0007274	neuromuscular synaptic transmission	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0071318	cellular response to ATP	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043195	terminal bouton	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0019228	neuronal action potential	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0001614	purinergic nucleotide receptor activity	IEA	molecular function
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0050909	sensory perception of taste	IEA	biological process
GO:0048167	regulation of synaptic plasticity	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030432	peristalsis	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0010033	response to organic substance	IEA	biological process
GO:0009743	response to carbohydrate	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0009266	response to temperature stimulus	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0006812	cation transport	IEA	biological process
GO:0004931	extracellularly ATP-gated cation channel activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001614	purinergic nucleotide receptor activity	NAS	molecular function
GO:0004931	extracellularly ATP-gated cation channel activity	NAS	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0010524	positive regulation of calcium ion transport into cytosol	NAS	biological process
GO:0050850	positive regulation of calcium-mediated signaling	NAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0035590	purinergic nucleotide receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway
hsa04742	Taste transduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq