• Gene id: 5021

Gene Summary

• Gene Symbol: OXTR   Gene   UCSC   Ensembl
• Aliases: OT-R
• Gene name: oxytocin receptor
• Alternate names: oxytocin receptor,
• Gene location: 3p25.3 (8769613: 8750407)     Exons: 6     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin rece
• OMIM: 167055

Protein Summary

• Protein general information: P30559  
  • Name: Oxytocin receptor (OT R)
  • Length: 389  
  • Mass: 42,772
• Sequence:

  MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQKHSRLF
  FFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRR
  RTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISF
  KIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
  DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSH
  RSSSQRSCSQPSTA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR002062  IPR001817  
  • Prosite: PS00237 PS50262
  • CDD: cd15387
  • STRING: ENSP00000324270
• Other Databases: GeneCards:  OXTR  Malacards:  OXTR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001967	suckling behavior	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0001992	regulation of systemic arterial blood pressure by vasopressin	IBA	biological process
GO:0004990	oxytocin receptor activity	IEA	molecular function
GO:0005000	vasopressin receptor activity	IBA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005913	cell-cell adherens junction	IEA	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007595	lactation	TAS	biological process
GO:0007613	memory	IEA	biological process
GO:0010701	positive regulation of norepinephrine secretion	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0021537	telencephalon development	IEA	biological process
GO:0030431	sleep	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0034059	response to anoxia	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0035176	social behavior	IBA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042711	maternal behavior	IBA	biological process
GO:0042713	sperm ejaculation	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060137	maternal process involved in parturition	IEA	biological process
GO:0060406	positive regulation of penile erection	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:1901652	response to peptide	IBA	biological process
GO:0001967	suckling behavior	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0001992	regulation of systemic arterial blood pressure by vasopressin	IBA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004990	oxytocin receptor activity	IEA	molecular function
GO:0004990	oxytocin receptor activity	IEA	molecular function
GO:0004990	oxytocin receptor activity	TAS	molecular function
GO:0005000	vasopressin receptor activity	IEA	molecular function
GO:0005000	vasopressin receptor activity	IBA	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0005913	cell-cell adherens junction	IEA	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0007595	lactation	TAS	biological process
GO:0007613	memory	IEA	biological process
GO:0010701	positive regulation of norepinephrine secretion	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0021537	telencephalon development	IEA	biological process
GO:0030431	sleep	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0034059	response to anoxia	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035176	social behavior	IBA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042711	maternal behavior	IEA	biological process
GO:0042711	maternal behavior	IBA	biological process
GO:0042713	sperm ejaculation	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0044058	regulation of digestive system process	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060137	maternal process involved in parturition	IEA	biological process
GO:0060406	positive regulation of penile erection	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0070371	ERK1 and ERK2 cascade	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:1901652	response to peptide	IBA	biological process
GO:0001992	regulation of systemic arterial blood pressure by vasopressin	IBA	biological process
GO:0004990	oxytocin receptor activity	TAS	molecular function
GO:0005000	vasopressin receptor activity	IBA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0007595	lactation	TAS	biological process
GO:0032870	cellular response to hormone stimulus	IBA	biological process
GO:0035176	social behavior	IBA	biological process
GO:0042277	peptide binding	IBA	molecular function
GO:0042711	maternal behavior	IBA	biological process
GO:0045907	positive regulation of vasoconstriction	IBA	biological process
GO:1901652	response to peptide	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04020	Calcium signaling pathway
hsa04024	cAMP signaling pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04921	Oxytocin signaling pathway

Diseases

Associated diseases	References
Irritable bowel syndrome	GAD: 19943975
Several psychiatric disorders	GAD: 19086053
Attention deficit disorder conduct disorder oppositional defiant disorder	GAD: 11140838
Autism	GAD: 15992526
Depression	GAD: 19515497
Chorioamnionitis	GAD: 20673868
Adenomyosis	INFBASE: 20096818
Male factor infertility	MIK: 21090345
Oligozoospermia	MIK: 20711752
Azoospermia	MIK: 20711752
Asthenozoospermia	MIK: 20711752
Dysperistalsis	INFBASE: 20413116
Childhood-onset mood disorders	GAD: 20547007
Male infertility	MIK: 20711752
Azoospermia	MIK: 20711752
Oligozoospermia	MIK: 20711752
Asthenozoospermia	MIK: 20711752
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21090345	Male infertility, asthenozoospermia, oligozoospermia			85 (20 idiopathic oligozoospermia, 25 idiopathic asthenozoospermia, 20 idiopathic oligoasthenozoospermia, 20 helathy controls)	Male infertility
20711752	Male infertility, azoospermia, oligozoospermia, asthenozoospermia			85 (20 obstructive azoospermia patients, 25 idiopathic asthenozoospermia patients, 20 idiopathic oligozoospermia patients, 20 healthy subjects)	Male infertility	oxytocin (OT)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)