• Gene id: 5020

Gene Summary

• Gene Symbol: OXT   Gene   UCSC   Ensembl
• Aliases: OT, OT-NPI, OXT-NPI
• Gene name: oxytocin/neurophysin I prepropeptide
• Alternate names: oxytocin-neurophysin 1, neurophysin I, oxytocin, prepro- (neurophysin I), oxytocin, prepropeptide, oxytocin-neurophysin I, preproprotein,
• Gene location: 20p13 (3068870: 3072516)     Exons: 4     NC_000020.11
• Gene summary(Entrez): This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Togeth
• OMIM: 167050

Protein Summary

• Protein general information: P01178  
  • Name: Oxytocin neurophysin 1 (OT NPI) [Cleaved into: Oxytocin (Ocytocin); Neurophysin 1]
  • Length: 125  
  • Mass: 12,722
• Sequence:

  MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRC
  QEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

• Structural information:
  • Interpro: IPR000981  IPR036387  IPR022423  
  • Prosite: PS00264
  • STRING: ENSP00000217386
• Other Databases: GeneCards:  OXT  Malacards:  OXT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001975	response to amphetamine	IEA	biological process
GO:0002027	regulation of heart rate	IEA	biological process
GO:0002125	maternal aggressive behavior	IEA	biological process
GO:0005185	neurohypophyseal hormone activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0009744	response to sucrose	IEA	biological process
GO:0010701	positive regulation of norepinephrine secretion	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030431	sleep	IEA	biological process
GO:0031855	oxytocin receptor binding	IEA	molecular function
GO:0032094	response to food	IEA	biological process
GO:0032308	positive regulation of prostaglandin secretion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0034695	response to prostaglandin E	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035811	negative regulation of urine volume	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0042711	maternal behavior	IEA	biological process
GO:0042713	sperm ejaculation	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0042756	drinking behavior	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0043434	response to peptide hormone	IEA	biological process
GO:0045472	response to ether	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0060179	male mating behavior	IEA	biological process
GO:0060406	positive regulation of penile erection	IEA	biological process
GO:0060450	positive regulation of hindgut contraction	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0002027	regulation of heart rate	IEA	biological process
GO:0002125	maternal aggressive behavior	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005185	neurohypophyseal hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0007625	grooming behavior	IEA	biological process
GO:0009744	response to sucrose	IEA	biological process
GO:0010701	positive regulation of norepinephrine secretion	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030431	sleep	IEA	biological process
GO:0031855	oxytocin receptor binding	IEA	molecular function
GO:0032094	response to food	IEA	biological process
GO:0032308	positive regulation of prostaglandin secretion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0032570	response to progesterone	IEA	biological process
GO:0034695	response to prostaglandin E	IEA	biological process
GO:0035176	social behavior	IEA	biological process
GO:0035811	negative regulation of urine volume	IEA	biological process
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042538	hyperosmotic salinity response	IEA	biological process
GO:0042711	maternal behavior	IEA	biological process
GO:0042713	sperm ejaculation	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0042756	drinking behavior	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0043434	response to peptide hormone	IEA	biological process
GO:0044058	regulation of digestive system process	IEA	biological process
GO:0045472	response to ether	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045777	positive regulation of blood pressure	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0048545	response to steroid hormone	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0060179	male mating behavior	IEA	biological process
GO:0060406	positive regulation of penile erection	IEA	biological process
GO:0060450	positive regulation of hindgut contraction	IEA	biological process
GO:0060455	negative regulation of gastric acid secretion	IEA	biological process
GO:0070474	positive regulation of uterine smooth muscle contraction	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa04080	Neuroactive ligand-receptor interaction
hsa04921	Oxytocin signaling pathway

Diseases

Associated diseases	References
Irritable bowel syndrome	GAD: 19943975
Hypercholesterolemia	GAD: 20602615
Attention deficit disorder conduct disorder oppositional defiant disorder	GAD: 11140838
Bulimia	GAD: 20468064
Psychological disorders	GAD: 19086053
Autism	GAD: 19058789
Azoospermia	MIK: 20711752
Asthenozoospermia	MIK: 20711752
Male factor infertility	MIK: 20711752
Oligozoospermia	MIK: 20711752
Childhood-onset mood disorders	GAD: 20547007
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 20711752
Azoospermia	MIK: 20711752
Oligozoospermia	MIK: 20711752
Asthenozoospermia	MIK: 20711752

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20711752	Male infertility, azoospermia, oligozoospermia, asthenozoospermia			85 (20 obstructive azoospermia patients, 25 idiopathic asthenozoospermia patients, 20 idiopathic oligozoospermia patients, 20 healthy subjects)	Male infertility	oxytocin (OT)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881