• Gene id: 5017

Gene Summary

• Gene Symbol: OVOL1   Gene   UCSC   Ensembl
• Aliases: HOVO1
• Gene name: ovo like transcriptional repressor 1
• Alternate names: putative transcription factor Ovo-like 1, ovo homolog-like 1, ovo like zinc finger 1, ovo-like 1(Drosophila),
• Gene location: 11q13.1 (65787062: 65797218)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene encodes a putative zinc finger containing transcription factor that is highly similar to homologous protein in Drosophila and mouse. Based on known functions in these species, this protein is likely involved in hair formation and spermatogenesis
• OMIM: 602313

Protein Summary

• Protein general information: O14753  
  • Name: Putative transcription factor Ovo like 1 (hOvo1)
  • Length: 267  
  • Mass: 30259
  • Tissue specificity: Expressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
• Sequence:

  MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPG
  PCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTY
  CGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQ
  EGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL

• Structural information:
  • Interpro: IPR027756  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000337862
• Other Databases: GeneCards:  OVOL1  Malacards:  OVOL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0009913	epidermal cell differentiation	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008544	epidermis development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:2000647	negative regulation of stem cell proliferation	IEA	biological process
GO:1901994	negative regulation of meiotic cell cycle phase transition	IEA	biological process
GO:0051729	germline cell cycle switching, mitotic to meiotic cell cycle	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0007498	mesoderm development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Non obstructive azoospermia, Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)