• Gene id: 5016

Gene Summary

• Gene Symbol: OVGP1   Gene   UCSC   Ensembl
• Aliases: CHIT5, EGP, MUC9, OGP
• Gene name: oviductal glycoprotein 1
• Alternate names: oviduct-specific glycoprotein, estrogen-dependent oviduct protein, mucin 9, oviduct glycoprotein, oviductal glycoprotein 1, 120kDa, oviductin,
• Gene location: 1p13.2 (111427734: 111414318)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a large, carbohydrate-rich, epithelial glycoprotein with numerous O-glycosylation sites located within threonine, serine, and proline-rich tandem repeats. The gene is similar to members of the mucin and the glycosyl hydrolase 18 gene fam
• OMIM: 618645

Protein Summary

• Protein general information: Q12889  
  • Name: Oviduct specific glycoprotein (Estrogen dependent oviduct protein) (Mucin 9) (Oviductal glycoprotein) (Oviductin)
  • Length: 678  
  • Mass: 75421
  • Tissue specificity: Oviduct.
• Sequence:

  MWKLLLWVGLVLVLKHHDGAAHKLVCYFTNWAHSRPGPASILPHDLDPFLCTHLIFAFASMNNNQIVAKDLQDEK
  ILYPEFNKLKERNRELKTLLSIGGWNFGTSRFTTMLSTFANREKFIASVISLLRTHDFDGLDLFFLYPGLRGSPM
  HDRWTFLFLIEELLFAFRKEALLTMRPRLLLSAAVSGVPHIVQTSYDVRFLGRLLDFINVLSYDLHGSWERFTGH
  NSPLFSLPEDPKSSAYAMNYWRKLGAPSEKLIMGIPTYGRTFRLLKASKNGLQARAIGPASPGKYTKQEGFLAYF
  EICSFVWGAKKHWIDYQYVPYANKGKEWVGYDNAISFSYKAWFIRREHFGGAMVWTLDMDDVRGTFCGTGPFPLV
  YVLNDILVRAEFSSTSLPQFWLSSAVNSSSTDPERLAVTTAWTTDSKILPPGGEAGVTEIHGKCENMTITPRGTT
  VTPTKETVSLGKHTVALGEKTEITGAMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKTLT
  PVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAPRRKAVAREKVTVPSRNISVTPEGQTMPLRGENLTSE
  VGTHPRMGNLGLQMEAENRMMLSSSPVIQLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVD
  EEA

• Structural information:
  • Protein Domains: (22..38-)
    (/note="GH18-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01258"-)
  • Interpro: IPR011583  IPR029070  IPR001223  IPR017853  
  • Prosite: PS51910
  • STRING: ENSP00000358747
• Other Databases: GeneCards:  OVGP1  Malacards:  OVGP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0008061	chitin binding	IBA	molecular function
GO:0004568	chitinase activity	IBA	molecular function
GO:0006032	chitin catabolic process	IBA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008061	chitin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0007339	binding of sperm to zona pellucida	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0098595	perivitelline space	IEA	cellular component
GO:0035805	egg coat	IEA	cellular component
GO:2000360	negative regulation of binding of sperm to zona pellucida	IEA	biological process
GO:0030133	transport vesicle	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray