• Gene id: 5010

Gene Summary

• Gene Symbol: CLDN11   Gene   UCSC   Ensembl
• Aliases: OSP, OTM
• Gene name: claudin 11
• Alternate names: claudin-11, oligodendrocyte transmembrane protein, oligodendrocyte-specific protein,
• Gene location: 3q26.2 (170418864: 170434690)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellula
• OMIM: 601326

Protein Summary

• Protein general information: O75508  
  • Name: Claudin 11 (Oligodendrocyte specific protein)
  • Length: 207  
  • Mass: 21,993
• Sequence:

  MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILP
  GYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETT
  IVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV

• Structural information:
  • Interpro: IPR006187  IPR003555  IPR017974  IPR004031  
  • Prosite: PS01346
  • STRING: ENSP00000064724
• Other Databases: GeneCards:  CLDN11  Malacards:  CLDN11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0008366	axon ensheathment	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0045178	basal part of cell	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0008366	axon ensheathment	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042802	identical protein binding	ISS	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0045178	basal part of cell	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0016338	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04530	Tight junction
hsa04670	Leukocyte transendothelial migration
hsa05130	Pathogenic Escherichia coli infection
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Mental disorder	GAD: 20889312
Spermatocytic and maturation arrest	MIK: 20850723
Primary seminiferous tubule failure	MIK: 23706332
Sertoli cell only syndrome (SCOS)	MIK: 20850723
Spermatogenesis defects	MIK: 22951003
Hypospermatogenesis	MIK: 20850723
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Spermatogenic defects	MIK: 22951003
Primary seminiferous tubule failure	MIK: 23706332
Sertoli cell only (SCO) testes	MIK: 20850723
Hypospermatogenesis	MIK: 20850723
Spermatocytic and maturation arrest	MIK: 20850723
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23706332	Primary seminiferous tubule failure			16 (6 with meiotic arrest, 7 with the Sertoli cell-only phenotype, 3 with normal spermatogenesis)	Male infertiltiy
22951003	Impaired spermatogenesis			55 (5 men with obstructive azoospermia, 50 men with nonobstructive azoospermia)	Male infertility	claudin-11
20850723	Sertoli cell only (SCO) testes, hypospermatogenesis, spermatocytic and maturation arrest				Male infertility	claudin-11
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray