• Gene id: 5008

Gene Summary

• Gene Symbol: OSM   Gene   UCSC   Ensembl
• Gene name: oncostatin M
• Alternate names: oncostatin-M,
• Gene location: 22q12.2 (30266850: 30262828)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that in
• OMIM: 131398

Protein Summary

• Protein general information: P13725  
  • Name: Oncostatin M (OSM)
  • Length: 252  
  • Mass: 28484
• Sequence:

  MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCR
  ERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNI
  YCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPH
  QALRKGVRRTRPSRKGKRLMTRGQLPR

• Structural information:
  • Interpro: IPR009079  IPR001581  IPR019827  IPR039578  
  • Prosite: PS00590
  • PDB: 1EVS
  • PDBsum: 1EVS
  • DIP: 5785
  • STRING: ENSP00000215781
• Other Databases: GeneCards:  OSM  Malacards:  OSM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005147	oncostatin-M receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0038165	oncostatin-M-mediated signaling pathway	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005147	oncostatin-M receptor binding	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:1905078	positive regulation of interleukin-17 secretion	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IGI	biological process
GO:0051897	positive regulation of protein kinase B signaling	IGI	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0038165	oncostatin-M-mediated signaling pathway	IDA	biological process
GO:0005147	oncostatin-M receptor binding	IPI	molecular function
GO:0005147	oncostatin-M receptor binding	IPI	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005147	oncostatin-M receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0038165	oncostatin-M-mediated signaling pathway	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0005147	oncostatin-M receptor binding	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0046888	negative regulation of hormone secretion	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:1905078	positive regulation of interleukin-17 secretion	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IGI	biological process
GO:0051897	positive regulation of protein kinase B signaling	IGI	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0038165	oncostatin-M-mediated signaling pathway	IDA	biological process
GO:0005147	oncostatin-M receptor binding	IPI	molecular function
GO:0005147	oncostatin-M receptor binding	IPI	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881