• Gene id: 5004

Gene Summary

• Gene Symbol: ORM1   Gene   UCSC   Ensembl
• Aliases: AGP-A, AGP1, HEL-S-153w, ORM
• Gene name: orosomucoid 1
• Alternate names: alpha-1-acid glycoprotein 1, AGP 1, OMD 1, epididymis secretory sperm binding protein Li 153w,
• Gene location: 9q32 (114323097: 114326478)     Exons: 6     NC_000009.12
• Gene summary(Entrez): This gene encodes a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however, it may be involved
• OMIM: 138600

Protein Summary

• Protein general information: P02763  
  • Name: Alpha 1 acid glycoprotein 1 (AGP 1) (Orosomucoid 1) (OMD 1)
  • Length: 201  
  • Mass: 23512
  • Tissue specificity: Expressed by the liver and secreted in plasma.
• Sequence:

  MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTE
  DTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPE
  TTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES

• Structural information:
  • Interpro: IPR001500  IPR012674  IPR000566  
  • PDB: 3KQ0
  • PDBsum: 3KQ0
  • STRING: ENSP00000259396
• Other Databases: GeneCards:  ORM1  Malacards:  ORM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0002682	regulation of immune system process	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006953	acute-phase response	IEA	biological process
GO:0006953	acute-phase response	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035580	specific granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:1904469	positive regulation of tumor necrosis factor secretion	IDA	biological process
GO:0050716	positive regulation of interleukin-1 secretion	IDA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)