• Gene id: 5000

Gene Summary

• Gene Symbol: ORC4   Gene   UCSC   Ensembl
• Aliases: ORC4L, ORC4P
• Gene name: origin recognition complex subunit 4
• Alternate names: origin recognition complex subunit 4, origin recognition complex, subunit 4 homolog,
• Gene location: 2q23.1 (148021603: 147930395)     Exons: 18     NC_000002.12
• Gene summary(Entrez): The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves
• OMIM: 613072

Protein Summary

• Protein general information: O43929  
  • Name: Origin recognition complex subunit 4
  • Length: 436  
  • Mass: 50377
• Sequence:

  MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTM
  LINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTS
  SCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQ
  YVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
  DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKA
  FEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL

• Structural information:
  • Interpro: IPR003593  IPR041664  IPR016527  IPR032705  IPR027417  
  • PDB: 5UJ7 5UJM
  • PDBsum: 5UJ7 5UJM
  • DIP: 29690
  • STRING: ENSP00000441953
• Other Databases: GeneCards:  ORC4  Malacards:  ORC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003688	DNA replication origin binding	IBA	molecular function
GO:0005664	nuclear origin of replication recognition complex	IBA	cellular component
GO:0006270	DNA replication initiation	IBA	biological process
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0000808	origin recognition complex	IDA	cellular component
GO:0000808	origin recognition complex	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000166	nucleotide binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006270	DNA replication initiation	IMP	biological process
GO:0003688	DNA replication origin binding	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Meier-Gorlin syndrome	KEGG:H01889
Meier-Gorlin syndrome	KEGG:H01889
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)