• Gene id: 4994

Gene Summary

• Gene Symbol: OR3A1   Gene   UCSC   Ensembl
• Aliases: OLFRA03, OR17-40, OR17-82, OR40
• Gene name: olfactory receptor family 3 subfamily A member 1
• Alternate names: olfactory receptor 3A1, Olfactory receptor-like protein OR17-82, olfactory receptor 17-40, olfactory receptor OR17-15,
• Gene location: 17p13.3 (3336086: 3288317)     Exons: 3     NC_000017.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 0

Protein Summary

• Protein general information: P47881  
  • Name: Olfactory receptor 3A1 (Olfactory receptor 17 40) (OR17 40) (Olfactory receptor OR17 15)
  • Length: 315  
  • Mass: 34609
• Sequence:

  MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVRGNLSILAAVLVEPKLHTPMYFFLGNLSVLDVG
  CISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTAMAYDRFLAICRPLTYSTRMSQTVQRMLVAA
  SWACAFTNALTHTVAMSTLNFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPMALIVISYIHVA
  AAVLRIRSVEGRKKAFSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIYSFRNPDV
  QSAIWRMLTGRRSLA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000313803
• Other Databases: GeneCards:  OR3A1  Malacards:  OR3A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004984	olfactory receptor activity	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)