• Gene id: 4992

Gene Summary

• Gene Symbol: OR1F1   Gene   UCSC   Ensembl
• Aliases: OLFMF, OR16-36, OR16-37, OR16-88, OR16-89, OR16-90, OR1F10, OR1F13P, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9, OR3-145, ORL1023
• Gene name: olfactory receptor family 1 subfamily F member 1
• Alternate names: olfactory receptor 1F1, olfactory receptor, family 1, subfamily F, member 10, olfactory receptor, family 1, subfamily F, member 13 pseudogene, olfactory receptor, family 1, subfamily F, member 4, olfactory receptor, family 1, subfamily F, member 5, olfactory r,
• Gene location: 16p13.3 (3188203: 3206555)     Exons: 6     NC_000016.10
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 616378

Protein Summary

• Protein general information: O43749  
  • Name: Olfactory receptor 1F1 (Olfactory receptor 16 35) (OR16 35) (Olfactory receptor 1F10) (Olfactory receptor 1F4) (Olfactory receptor 1F5) (Olfactory receptor 1F6) (Olfactory receptor 1F7) (Olfactory receptor 1F8) (Olfactory receptor 1F9) (Olfactory receptor
  • Length: 312  
  • Mass: 34866
• Sequence:

  MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMYFFLSNLSFVDICFSF
  TTVPKMLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAYDHFVAVCHPLHYTAKMTHQLCALLVAGLWV
  VANLNVLLHTLLMAPLSFCADNAITHFFCDVTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTV
  LKVPSTKGRWKAFSTCGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPMLNPFIYSLRNRYLKGA
  LKKVVGRVVFSV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS50262
  • STRING: ENSP00000305424
• Other Databases: GeneCards:  OR1F1  Malacards:  OR1F1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq