• Gene id: 4987

Gene Summary

• Gene Symbol: OPRL1   Gene   UCSC   Ensembl
• Aliases: KOR-3, KOR3, NOCIR, NOP, NOPr, OOR, OPRL, ORL1
• Gene name: opioid related nociceptin receptor 1
• Alternate names: nociceptin receptor, kappa-type 3 opioid receptor, kappa3-related opioid receptor, nociceptin/orphanin FQ receptor, opiate receptor-like 1, orphanin FQ receptor,
• Gene location: 20q13.33 (64080081: 64100642)     Exons: 8     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the 7 transmembrane-spanning G protein-coupled receptor family, and functions as a receptor for the endogenous, opioid-related neuropeptide, nociceptin/orphanin FQ. This receptor-ligand system modulates a va
• OMIM: 600843

Protein Summary

• Protein general information: P41146  
  • Name: Nociceptin receptor (Kappa type 3 opioid receptor) (KOR 3) (Orphanin FQ receptor)
  • Length: 370  
  • Mass: 40693
  • Tissue specificity: Detected in blood leukocytes. {ECO
• Sequence:

  MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLAVCVGGLLGNCLVMYV
  ILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYV
  AICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFI
  VPVLVISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
  LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALACKTSETVPRPA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR001418  IPR001420  
  • Prosite: PS00237 PS50262
  • PDB: 4EA3 5DHG 5DHH
  • PDBsum: 4EA3 5DHG 5DHH
  • STRING: ENSP00000336764
• Other Databases: GeneCards:  OPRL1  Malacards:  OPRL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0042277	peptide binding	IBA	molecular function
GO:0019233	sensory perception of pain	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0001626	nociceptin receptor activity	IBA	molecular function
GO:0001626	nociceptin receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0019233	sensory perception of pain	ISS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IMP	biological process
GO:0004930	G protein-coupled receptor activity	IMP	molecular function
GO:0001626	nociceptin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004985	opioid receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007610	behavior	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007600	sensory perception	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0060454	positive regulation of gastric acid secretion	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:1904059	regulation of locomotor rhythm	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0035810	positive regulation of urine volume	IEA	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	IEA	biological process
GO:0044849	estrous cycle	IEA	biological process
GO:0106072	negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:1901386	negative regulation of voltage-gated calcium channel activity	IEA	biological process
GO:1990708	conditioned place preference	IEA	biological process
GO:0001626	nociceptin receptor activity	IEA	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0032355	response to estradiol	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001626	nociceptin receptor activity	IDA	molecular function
GO:0038003	opioid receptor signaling pathway	IDA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IPI	biological process
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function
GO:0004930	G protein-coupled receptor activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R