• Gene id: 4986

Gene Summary

• Gene Symbol: OPRK1   Gene   UCSC   Ensembl
• Aliases: K-OR-1, KOP, KOR, KOR-1, KOR1, OPRK
• Gene name: opioid receptor kappa 1
• Alternate names: kappa-type opioid receptor, Opiate receptor, kappa-1, kappa opioid receptor,
• Gene location: 8q11.23 (53251696: 53225715)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes an opioid receptor, which is a member of the 7 transmembrane-spanning G protein-coupled receptor family. It functions as a receptor for endogenous ligands, as well as a receptor for various synthetic opioids. Ligand binding results in in
• OMIM: 605065

Protein Summary

• Protein general information: P41145  
  • Name: Kappa type opioid receptor (K OR 1) (KOR 1)
  • Length: 380  
  • Mass: 42645
  • Tissue specificity: Detected in brain and placenta. {ECO
• Sequence:

  MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLV
  GNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLT
  MMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLF
  MKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
  STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDG
  MNKPV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000452  IPR001418  
  • Prosite: PS00237 PS50262
  • PDB: 2A0D 2IQN 4DJH 6B73
  • PDBsum: 2A0D 2IQN 4DJH 6B73
  • STRING: ENSP00000265572
• Other Databases: GeneCards:  OPRK1  Malacards:  OPRK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043005	neuron projection	IBA	cellular component
GO:0038048	dynorphin receptor activity	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0042277	peptide binding	IBA	molecular function
GO:0038003	opioid receptor signaling pathway	IBA	biological process
GO:0019233	sensory perception of pain	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0031635	adenylate cyclase-inhibiting opioid receptor signaling pathway	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0004985	opioid receptor activity	IDA	molecular function
GO:0046877	regulation of saliva secretion	ISS	biological process
GO:0038048	dynorphin receptor activity	IMP	molecular function
GO:0007626	locomotory behavior	ISS	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0019233	sensory perception of pain	ISS	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0038048	dynorphin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004985	opioid receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007610	behavior	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007600	sensory perception	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0038048	dynorphin receptor activity	IDA	molecular function
GO:0006955	immune response	IDA	biological process
GO:0038003	opioid receptor signaling pathway	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray