• Gene id: 49856

Gene Summary

• Gene Symbol: WRAP73   Gene   UCSC   Ensembl
• Aliases: WDR8
• Gene name: WD repeat containing, antisense to TP73
• Alternate names: WD repeat-containing protein WRAP73, WD repeat domain 8, epididymis secretory sperm binding protein,
• Gene location: 1p36.32 (49640142: 49635291)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• OMIM: 606040

Protein Summary

• Protein general information: Q9P2S5  
  • Name: WD repeat containing protein WRAP73 (WD repeat containing protein 8) (WD repeat containing protein antisense to TP73 gene)
  • Length: 460  
  • Mass: 51588
  • Tissue specificity: Ubiquitous. Predominant expression in heart, brain, liver, thymus, prostate, and testis, and barely detectable expression in lung.
• Sequence:

  MNFSEVFKLSSLLCKFSPDGKYLASCVQYRLVVRDVNTLQILQLYTCLDQIQHIEWSADSLFILCAMYKRGLVQV
  WSLEQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPKACLQGITFTRDGRYMAL
  AERRDCKDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVWDTCLEYKILLYSLDGRLLSTYSAYEWSLG
  IKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEFGHPAAINDPKIVVYKEAEKSPQLGLGCLSFPPPRAGAGP
  LPSSESKYEIASVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSP
  VRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSMALLSKDHFCLCFLETEAVVG
  TACRQLGGHT

• Structural information:
  • Interpro: IPR024977  IPR015943  IPR001680  
  • STRING: ENSP00000270708
• Other Databases: GeneCards:  WRAP73  Malacards:  WRAP73

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0072686	mitotic spindle	IBA	cellular component
GO:1902440	protein localization to mitotic spindle pole body	IBA	biological process
GO:1990811	MWP complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:1902857	positive regulation of non-motile cilium assembly	IMP	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq