• Gene id: 4985

Gene Summary

• Gene Symbol: OPRD1   Gene   UCSC   Ensembl
• Aliases: DOP, DOR, DOR1, OPRD
• Gene name: opioid receptor delta 1
• Alternate names: delta-type opioid receptor, D-OR-1, DOR-1, delta opioid receptor 1, opioid receptor delta 1 isoform DOR-1B, opioid receptor delta 1 isoform DOR-1C, opioid receptor delta 1 isoform DOR-1D, opioid receptor delta 1 isoform DOR-1E,
• Gene location: 1p35.3 (28812169: 28871266)     Exons: 3     NC_000001.11
• OMIM: 165195

SNPs

rs16968382

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.76586021A>C
NC_000015.9   g.76878362A>C|SEQ=[A/C]|GENE=SCAPER
MIR3713   100500855

Protein Summary

• Protein general information: P41143  
  • Name: Delta type opioid receptor (D OR 1) (DOR 1)
  • Length: 372  
  • Mass: 40369
  • Tissue specificity: Detected in oocytes (at protein level). Detected in brain cortex, hypothalamus, hippocampus and olfactory bulb. Detected in oocytes. {ECO
• Sequence:

  MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIV
  RYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAV
  CHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVP
  ILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
  HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA

• Structural information:
  • Interpro: IPR000321  IPR000276  IPR017452  IPR001418  
  • Prosite: PS00237 PS50262
  • PDB: 1OZC 2IQM 4N6H 4RWA 4RWD
  • PDBsum: 1OZC 2IQM 4N6H 4RWA 4RWD
  • STRING: ENSP00000234961
• Other Databases: GeneCards:  OPRD1  Malacards:  OPRD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0031333	negative regulation of protein-containing complex assembly	IDA	biological process
GO:0032793	positive regulation of CREB transcription factor activity	IC	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0097237	cellular response to toxic substance	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0038046	enkephalin receptor activity	IBA	molecular function
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0042923	neuropeptide binding	IBA	molecular function
GO:0042277	peptide binding	IBA	molecular function
GO:0038003	opioid receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004985	opioid receptor activity	IDA	molecular function
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	ISS	biological process
GO:0038046	enkephalin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004985	opioid receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0038046	enkephalin receptor activity	IEA	molecular function
GO:0042755	eating behavior	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0098992	neuronal dense core vesicle	IEA	cellular component
GO:0004985	opioid receptor activity	IEA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0032590	dendrite membrane	IEA	cellular component
GO:0033612	receptor serine/threonine kinase binding	IEA	molecular function
GO:0043679	axon terminus	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0097444	spine apparatus	IEA	cellular component
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0038046	enkephalin receptor activity	IMP	molecular function
GO:0038003	opioid receptor signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04022	cGMP-PKG signaling pathway
hsa04071	Sphingolipid signaling pathway

Diseases

Associated diseases	References
Eating Disorders	KEGG:H01703
Eating Disorders	KEGG:H01703
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq