• Gene id: 4982

Gene Summary

• Gene Symbol: TNFRSF11B   Gene   UCSC   Ensembl
• Aliases: OCIF, OPG, PDB5, TR1
• Gene name: TNF receptor superfamily member 11b
• Alternate names: tumor necrosis factor receptor superfamily member 11B, osteoclastogenesis inhibitory factor, osteoprotegerin, tumor necrosis factor receptor superfamily, member 11b,
• Gene location: 8q24.12 (118951884: 118923556)     Exons: 5     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin l
• OMIM: 602643

Protein Summary

• Protein general information: O00300  
  • Name: Tumor necrosis factor receptor superfamily member 11B (Osteoclastogenesis inhibitory factor) (Osteoprotegerin)
  • Length: 401  
  • Mass: 46026
  • Tissue specificity: Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal m
• Sequence:

  MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWH
  TSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFF
  SNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVD
  NLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLME
  SLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSF
  TMYKLYQKLFLEMIGNQVQSVKISCL

• Structural information:
  • Protein Domains: (198..26-)
    (/note="Death-1)
    (270..36-)
    (/note="Death-2")
  • Interpro: IPR011029  IPR000488  IPR001368  IPR022323  IPR017371   IPR011641  
  • Prosite: PS00652 PS50050
  • PDB: 3URF
  • PDBsum: 3URF
  • STRING: ENSP00000297350
• Other Databases: GeneCards:  TNFRSF11B  Malacards:  TNFRSF11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005125	cytokine activity	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0043627	response to estrogen	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0042489	negative regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0046685	response to arsenic-containing substance	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042489	negative regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0032026	response to magnesium ion	IEA	biological process
GO:0010035	response to inorganic substance	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04380	Osteoclast differentiation

Diseases

Associated diseases	References
Paget disease of bone	KEGG:H00437
Paget disease of bone	KEGG:H00437
Lupus nephritis	PMID:21691937
Hereditary arterial and articular multiple calcification syndrome	PMID:22386825
Charcot-Marie-Tooth disease	PMID:21659498
Hypertension	PMID:22050177
Nephrotic syndrome	PMID:22989431
secondary hyperparathyroidism	PMID:22156488
Aortic valve stenosis	PMID:20211333
Bipolar disorder	PMID:20861651
Coronary artery disease	PMID:15926884
Carotid artery disease	PMID:15117849
Peripheral vascular disease	PMID:16115489
Cerebral infarction	PMID:19895657
Coronary stenosis	PMID:15569000
Paget's disease of bone	PMID:12189164
Schizophrenia	PMID:20861651
Myocardial infarction	PMID:15926884
Osteoarthritis	PMID:15334463
type 2 diabetes mellitus	PMID:22050177
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881