• Gene id: 4978

Gene Summary

• Gene Symbol: OPCML   Gene   UCSC   Ensembl
• Aliases: IGLON1, OBCAM, OPCM
• Gene name: opioid binding protein/cell adhesion molecule like
• Alternate names: opioid-binding protein/cell adhesion molecule, IgLON family member 1, opioid binding protein/cell adhesion molecule-like preprotein,
• Gene location: 11q25 (133532533: 132403360)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. The encoded preprotein is proteolytically processed to generate the mature protein. This protein is localized in the plasma membrane and may have an a
• OMIM: 600632

Protein Summary

• Protein general information: Q14982  
  • Name: Opioid binding protein/cell adhesion molecule (OBCAM) (OPCML) (Opioid binding cell adhesion molecule) (IgLON family member 1)
  • Length: 345  
  • Mass: 38008
• Sequence:

  MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTIL
  YAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEG
  SSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPY
  ISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATN
  KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF

• Structural information:
  • Protein Domains: (39..12-)
    1 (/note="Ig-like-C2-type)
    (136..21-)
    2 (/note="Ig-like-C2-type)
    (223..31-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  
  • Prosite: PS50835
  • PDB: 5UV6
  • PDBsum: 5UV6
  • STRING: ENSP00000330862
• Other Databases: GeneCards:  OPCML  Malacards:  OPCML

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007155	cell adhesion	IEA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0008038	neuron recognition	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq