• Gene id: 4975

Gene Summary

• Gene Symbol: OMP   Gene   UCSC   Ensembl
• Gene name: olfactory marker protein
• Alternate names: olfactory marker protein, olfactory neuronal-specific protein,
• Gene location: 11q13.5 (77102839: 77103330)     Exons: 1     NC_000011.10
• Gene summary(Entrez): Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse
• OMIM: 602548

Protein Summary

• Protein general information: P47874  
  • Name: Olfactory marker protein (Olfactory neuronal specific protein)
  • Length: 163  
  • Mass: 18937
  • Tissue specificity: Uniquely associated with mature olfactory receptor neurons.
• Sequence:

  MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKP
  GKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVE
  PANLKASVVFNQL

• Structural information:
  • Interpro: IPR009103  IPR036727  
  • STRING: ENSP00000436376
• Other Databases: GeneCards:  OMP  Malacards:  OMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0007608	sensory perception of smell	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0007608	sensory perception of smell	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0030424	axon	IEA	cellular component
GO:0022008	neurogenesis	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq