• Gene id: 4973

Gene Summary

• Gene Symbol: OLR1   Gene   UCSC   Ensembl
• Aliases: CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
• Gene name: oxidized low density lipoprotein receptor 1
• Alternate names: oxidized low-density lipoprotein receptor 1, C-type lectin domain family 8 member A, hLOX-1, lectin-type oxidized LDL receptor 1, ox LDL receptor 1, oxidized low density lipoprotein (lectin-like) receptor 1, oxidized low-density lipoprotein receptor 1, soluble ,
• Gene location: 12p13.2 (10172190: 10158299)     Exons: 6     NC_000012.12
• Gene summary(Entrez): This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. Thi
• OMIM: 602601

Protein Summary

• Protein general information: P78380  
  • Name: Oxidized low density lipoprotein receptor 1 (Ox LDL receptor 1) (C type lectin domain family 8 member A) (Lectin like oxidized LDL receptor 1) (LOX 1) (Lectin like oxLDL receptor 1) (hLOX 1) (Lectin type oxidized LDL receptor 1) [Cleaved into: Oxidized lo
  • Length: 273  
  • Mass: 30959
  • Tissue specificity: Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expre
• Sequence:

  MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLT
  HQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIW
  HGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMP
  HLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

• Structural information:
  • Protein Domains: (151..26-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR013600  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • PDB: 1YPO 1YPQ 1YPU 1YXJ 1YXK 3VLG
  • PDBsum: 1YPO 1YPQ 1YPU 1YXJ 1YXK 3VLG
  • DIP: 42040
  • STRING: ENSP00000309124
• Other Databases: GeneCards:  OLR1  Malacards:  OLR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0042157	lipoprotein metabolic process	IBA	biological process
GO:0007159	leukocyte cell-cell adhesion	IBA	biological process
GO:0008219	cell death	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005041	low-density lipoprotein particle receptor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0008015	blood circulation	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0006897	endocytosis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Coronary artery disease	PMID:12810610
Coronary artery disease	PMID:15562935
Myocardial infarction	PMID:12646194
Cerebral amyloid angiopathy	PMID:16328515
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R