About Us

Search Result


Gene id 497189
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol TIFAB   Gene   UCSC   Ensembl
Gene name TIFA inhibitor
Alternate names TRAF-interacting protein with FHA domain-containing protein B, TIFA-like protein, TIFA-related protein TIFAB, TRAF-interacting protein with forkhead-associated domain, family member B,
Gene location 5q31.1 (135452350: 135444225)     Exons: 2     NC_000005.10
Gene summary(Entrez) TIFAB associates with TIFA (MIM 609028) and inhibits TIFA-mediated activation of NF-kappa-B (NFKB1; MIM 164011) (Matsumura et al., 2004 [PubMed 15047173]).[supplied by OMIM, Mar 2009]
OMIM 612663

Protein Summary

Protein general information Q6ZNK6  

Name: TRAF interacting protein with FHA domain containing protein B (TIFA like protein)

Length: 161  Mass: 17888

Sequence MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSLEPYLEKGSALLAFCL
KALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEG
ISQGQPPPGSG
Structural information
Protein Domains
(36..9-)
(/note="FHA-)
(/evidence="ECO:0000255"-)
Interpro:  IPR000253  IPR008984  IPR033621  
CDD:   cd00060
STRING:   ENSP00000440509
Other Databases GeneCards:  TIFAB  Malacards:  TIFAB

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0007356 thorax and anterior abdom
en determination
IGI biological process
GO:0035112 genitalia morphogenesis
IGI biological process
GO:1901078 negative regulation of re
laxation of muscle
IGI biological process
GO:0042472 inner ear morphogenesis
IGI biological process
GO:0098583 learned vocalization beha
vior
IGI biological process
GO:1905747 negative regulation of sa
liva secretion
IGI biological process
GO:1905748 hard palate morphogenesis
IGI biological process
GO:0021559 trigeminal nerve developm
ent
IGI biological process
GO:0048806 genitalia development
IGI biological process
GO:0021650 vestibulocochlear nerve f
ormation
IGI biological process
GO:0031223 auditory behavior
IGI biological process
GO:0048634 regulation of muscle orga
n development
IGI biological process
GO:0050885 neuromuscular process con
trolling balance
IGI biological process
GO:0030432 peristalsis
IGI biological process
GO:0071626 mastication
IGI biological process
GO:0097094 craniofacial suture morph
ogenesis
IGI biological process
GO:0048839 inner ear development
IGI biological process
GO:0090102 cochlea development
IGI biological process
GO:0090103 cochlea morphogenesis
IGI biological process
GO:0007249 I-kappaB kinase/NF-kappaB
signaling
IEA biological process
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract