• Gene id: 4953

Gene Summary

• Gene Symbol: ODC1   Gene   UCSC   Ensembl
• Aliases: ODC
• Gene name: ornithine decarboxylase 1
• Alternate names: ornithine decarboxylase,
• Gene location: 2p25.1 (10448326: 10439967)     Exons: 13     NC_000002.12
• Gene summary(Entrez): This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to o
• OMIM: 165640

Protein Summary

• Protein general information: P11926  
  • Name: Ornithine decarboxylase (ODC) (EC 4.1.1.17)
  • Length: 461  
  • Mass: 51148
• Sequence:

  MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKA
  IVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAK
  LVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEV
  GFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
  TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEM
  HVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGMKRH
  RAACASASINV

• Structural information:
  • Interpro: IPR009006  IPR022643  IPR022657  IPR022644  IPR022653   IPR000183  IPR002433  IPR029066  
  • Prosite: PS00878 PS00879
  • PDB: 1D7K 2ON3 2OO0 4ZGY 5BWA
  • PDBsum: 1D7K 2ON3 2OO0 4ZGY 5BWA
  • STRING: ENSP00000234111
• Other Databases: GeneCards:  ODC1  Malacards:  ODC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004586	ornithine decarboxylase activity	IBA	molecular function
GO:0033387	putrescine biosynthetic process from ornithine	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004586	ornithine decarboxylase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0004586	ornithine decarboxylase activity	ISS	molecular function
GO:0005737	cytoplasm	ISS	cellular component
GO:0042176	regulation of protein catabolic process	ISS	biological process
GO:0033387	putrescine biosynthetic process from ornithine	ISS	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0016831	carboxy-lyase activity	IEA	molecular function
GO:0004586	ornithine decarboxylase activity	IEA	molecular function
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0004586	ornithine decarboxylase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006595	polyamine metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001822	kidney development	IEA	biological process
GO:0004586	ornithine decarboxylase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0004586	ornithine decarboxylase activity	IEA	molecular function
GO:0006595	polyamine metabolic process	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0033387	putrescine biosynthetic process from ornithine	IEA	biological process
GO:0042176	regulation of protein catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0009446	putrescine biosynthetic process	IEA	biological process
GO:0033387	putrescine biosynthetic process from ornithine	IEA	biological process
GO:0009615	response to virus	IEP	biological process
GO:0004586	ornithine decarboxylase activity	TAS	molecular function
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism
hsa00480	Glutathione metabolism
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq