• Gene id: 4947

Gene Summary

• Gene Symbol: OAZ2   Gene   UCSC   Ensembl
• Aliases: AZ2
• Gene name: ornithine decarboxylase antizyme 2
• Alternate names: ornithine decarboxylase antizyme 2, ODC-Az 2,
• Gene location: 15q22.31 (64703280: 64687573)     Exons: 5     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamines. Expression of antizymes requires +1 ribosomal frameshifting, which is enha
• OMIM: 604152

Protein Summary

• Protein general information: O95190  
  • Name: Ornithine decarboxylase antizyme 2 (AZ2) (ODC Az 2)
  • Length: 189  
  • Mass: 21011
• Sequence:

  MINTQDSSILPLSNCPQLQCCRHIVPGPLWCSDAPHPLSKIPGGRGGGRDPSLSALIYKDEKLTVTQDLPVNDGK
  PHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLL
  KTFSFLGFEIVRPGHPCVPSRPDVMFMVYPLDQNLSDED

• Structural information:
  • Interpro: IPR016181  IPR029916  IPR002993  IPR038581  
  • Prosite: PS01337
  • STRING: ENSP00000463013
• Other Databases: GeneCards:  OAZ2  Malacards:  OAZ2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008073	ornithine decarboxylase inhibitor activity	IBA	molecular function
GO:0045732	positive regulation of protein catabolic process	IBA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IDA	molecular function
GO:0090316	positive regulation of intracellular protein transport	ISS	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006595	polyamine metabolic process	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IEA	molecular function
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008073	ornithine decarboxylase inhibitor activity	TAS	molecular function
GO:0006595	polyamine metabolic process	TAS	biological process
GO:0006521	regulation of cellular amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090316	positive regulation of intracellular protein transport	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0008073	ornithine decarboxylase inhibitor activity	IEA	molecular function
GO:1902268	negative regulation of polyamine transmembrane transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)