• Gene id: 494115

Gene Summary

• Gene Symbol: RBMXL1   Gene   UCSC   Ensembl
• Aliases: RBM1
• Gene name: RBMX like 1
• Alternate names: RNA binding motif protein, X-linked-like-1, RNA binding motif protein, X-linked like 1, heterogeneous nuclear ribonucleoprotein G-like 1,
• Gene location: 1p22.2 (88992959: 88979455)     Exons: 3     NC_000001.11
• Gene summary(Entrez): This gene represents a retrogene of RNA binding motif protein, X-linked (RBMX), which is located on chromosome X. While all introns in the coding sequence have been processed out compared to the RBMX locus, the ORF is intact and there is specific evidence
• OMIM: 609074

Protein Summary

• Protein general information: Q96E39  
  • Name: RNA binding motif protein, X linked like 1 (Heterogeneous nuclear ribonucleoprotein G like 1)
  • Length: 390  
  • Mass: 42142
• Sequence:

  MVEADRPGKLFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLD
  GKAIKVEQATKPSFERGRHGPPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNFNMSSSRGPLPVK
  RGPPPRSGGPSPKRSAPSGLVRSSSGMGGRAPLSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDY
  PSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPLTRGP
  PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSCDRVGRQERGLPPSVERGYPSSRDSYSSSSRGAPRGAG
  PGGSRSDRGGGRSRY

• Structural information:
  • Protein Domains: (8..8-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR012604  IPR000504  IPR003954  
  • Prosite: PS50102
  • STRING: ENSP00000446099
• Other Databases: GeneCards:  RBMXL1  Malacards:  RBMXL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005681	spliceosomal complex	IBA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IBA	biological process
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881