• Gene id: 4939

Gene Summary

• Gene Symbol: OAS2   Gene   UCSC   Ensembl
• Gene name: 2'-5'-oligoadenylate synthetase 2
• Alternate names: 2'-5'-oligoadenylate synthase 2, (2'-5')oligo(A) synthetase 2, 2'-5'-oligoadenylate synthetase 2, 69/71kDa, 2-5A synthase 2, p69 OAS / p71 OAS,
• Gene location: 12q24.13 (112978465: 113011722)     Exons: 10     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer react
• OMIM: 615826

Protein Summary

• Protein general information: P29728  
  • Name: 2' 5' oligoadenylate synthase 2 ((2 5')oligo(A) synthase 2) (2 5A synthase 2) (EC 2.7.7.84) (p69 OAS / p71 OAS) (p69OAS / p71OAS)
  • Length: 719  
  • Mass: 82431
• Sequence:

  MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDG
  TLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISFEVLAAFNALS
  LNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQCQKKIKDLPSLSPYAL
  ELLTVYAWEQGCRKDNFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNILLHQLQSARPVILDPVDPTNN
  VSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRT
  FLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEEL
  EVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFT
  VLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVT
  QYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGN
  PIPPWKVPTMQTPGSCGARIHPIVNEMFSSRSHRILNNNSKRNF

• Structural information:
  • Interpro: IPR006117  IPR006116  IPR018952  IPR038121  IPR026774   IPR002934  
  • Prosite: PS00832 PS00833 PS50152
  • STRING: ENSP00000342278
• Other Databases: GeneCards:  OAS2  Malacards:  OAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001730	2'-5'-oligoadenylate synthetase activity	IBA	molecular function
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0060700	regulation of ribonuclease activity	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0001730	2'-5'-oligoadenylate synthetase activity	IDA	molecular function
GO:0009615	response to virus	TAS	biological process
GO:0060337	type I interferon signaling pathway	ISS	biological process
GO:0051607	defense response to virus	ISS	biological process
GO:0005524	ATP binding	IMP	molecular function
GO:0003725	double-stranded RNA binding	IMP	molecular function
GO:0001730	2'-5'-oligoadenylate synthetase activity	IMP	molecular function
GO:1903487	regulation of lactation	ISS	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0001730	2'-5'-oligoadenylate synthetase activity	IEA	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0043231	intracellular membrane-bounded organelle	TAS	cellular component
GO:0001730	2'-5'-oligoadenylate synthetase activity	IEA	molecular function
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051607	defense response to virus	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060337	type I interferon signaling pathway	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0006401	RNA catabolic process	IEA	biological process
GO:1903487	regulation of lactation	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0001730	2'-5'-oligoadenylate synthetase activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05162	Measles

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R