• Gene id: 493829

Gene Summary

• Gene Symbol: TRIM72   Gene   UCSC   Ensembl
• Aliases: MG53
• Gene name: tripartite motif containing 72
• Alternate names: tripartite motif-containing protein 72, mitsugumin-53, tripartite motif containing 72, E3 ubiquitin protein ligase,
• Gene location: 16p11.2 (31214118: 31231536)     Exons: 8     NC_000016.10
• OMIM: 616572

Protein Summary

• Protein general information: Q6ZMU5  
  • Name: Tripartite motif containing protein 72 (Mitsugumin 53) (Mg53)
  • Length: 477  
  • Mass: 52731
• Sequence:

  MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQLARLV
  EGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKS
  VAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKV
  LEEVADKPQTEFLMKYCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKMFRALMPALEELTFDPSSAHP
  SLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVDVGDKPRWALGVIAAEAPRRGRLHAV
  PSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVY
  PFFDVCWHDKGKNAQPLLLVGPEGAEA

• Structural information:
  • Protein Domains: (271..47-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR035038  IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021
  • PDB: 3KB5
  • PDBsum: 3KB5
  • STRING: ENSP00000312675
• Other Databases: GeneCards:  TRIM72  Malacards:  TRIM72

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0042383	sarcolemma	IBA	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0007517	muscle organ development	ISS	biological process
GO:0001786	phosphatidylserine binding	ISS	molecular function
GO:0051260	protein homooligomerization	ISS	biological process
GO:0042383	sarcolemma	ISS	cellular component
GO:0003012	muscle system process	ISS	biological process
GO:0001778	plasma membrane repair	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0001778	plasma membrane repair	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0043569	negative regulation of insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0010832	negative regulation of myotube differentiation	IEA	biological process
GO:0007517	muscle organ development	IEA	biological process
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0051260	protein homooligomerization	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0031624	ubiquitin conjugating enzyme binding	IEA	molecular function
GO:0003012	muscle system process	IEA	biological process
GO:0001778	plasma membrane repair	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq