• Gene id: 4928

Gene Summary

• Gene Symbol: NUP98   Gene   UCSC   Ensembl
• Aliases: ADIR2, NUP196, NUP96, Nup98-96
• Gene name: nucleoporin 98 and 96 precursor
• Alternate names: nuclear pore complex protein Nup98-Nup96, nuclear pore complex protein Nup98, GLFG-repeat containing nucleoporin, NUP98/PHF23 fusion 2 protein, Nup98-Nup96, nucleoporin 96, nucleoporin 98kD, nucleoporin 98kDa,
• Gene location: 11p15.4 (3797553: 3675009)     Exons: 34     NC_000011.10
• Gene summary(Entrez): Nuclear pore complexes (NPCs) regulate the transport of macromolecules between the nucleus and cytoplasm, and are composed of many polypeptide subunits, many of which belong to the nucleoporin family. This gene belongs to the nucleoporin gene family and e
• OMIM: 601021

Protein Summary

• Protein general information: P52948  
  • Name: Nuclear pore complex protein Nup98 Nup96 (EC 3.4.21. ) [Cleaved into: Nuclear pore complex protein Nup98 (98 kDa nucleoporin) (Nucleoporin Nup98) (Nup98); Nuclear pore complex protein Nup96 (96 kDa nucleoporin) (Nucleoporin Nup96) (Nup96)]
  • Length: 1817  
  • Mass: 197579
• Sequence:

  MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPGGLFGTSSFSQPATST
  STGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNFGTSTSSGGLFGTTNTTSNPFGSTSGSLFGP
  SSFTAAPTGTTIKFNPPTGTDTMVKAGVSTNISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTT
  GLFGSSPATSSATGLFSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
  SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAVGSTLFGNNKLTTFGS
  STTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIFGSKPAPGTLGTGLGAGFGTALGAGQASLFG
  NNQPKIGGPLGTGAFGAPGFNTTTATLGFGAPQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSD
  PKKKEERLKPTNPAAQKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
  VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAG
  NKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDL
  AKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDG
  VWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS
  TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVS
  ASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKADTSQEICSPRLPISASHSSKTRSLVGGLLQ
  SKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVT
  YGKGKLLMDMALFMGRSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
  LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTL
  CEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLA
  QQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWK
  RSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS
  DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNS
  GIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLI
  IRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTS
  LCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE
  LRSLTQSYLRELAVGSL

• Structural information:
  • Protein Domains: (738..88-)
    (/note="Peptidase-S59)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00765"-)
  • Interpro: IPR037665  IPR021967  IPR037637  IPR007230  IPR036903  
  • Prosite: PS51434
  • PDB: 1KO6 2Q5X 2Q5Y 3MMY 4OWR 5A9Q 6BZM
  • PDBsum: 1KO6 2Q5X 2Q5Y 3MMY 4OWR 5A9Q 6BZM
  • DIP: 32484
  • STRING: ENSP00000316032
• Other Databases: GeneCards:  NUP98  Malacards:  NUP98

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IDA	cellular component
GO:0044614	nuclear pore cytoplasmic filaments	IBA	cellular component
GO:0034398	telomere tethering at nuclear periphery	IBA	biological process
GO:0017056	structural constituent of nuclear pore	IBA	molecular function
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0006405	RNA export from nucleus	IBA	biological process
GO:0006606	protein import into nucleus	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0000973	posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery	IBA	biological process
GO:0034399	nuclear periphery	IDA	cellular component
GO:0034399	nuclear periphery	IDA	cellular component
GO:0031080	nuclear pore outer ring	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0000776	kinetochore	IDA	colocalizes with
GO:0044615	nuclear pore nuclear basket	IDA	cellular component
GO:0042405	nuclear inclusion body	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0051292	nuclear pore complex assembly	IMP	biological process
GO:0031080	nuclear pore outer ring	NAS	cellular component
GO:0017056	structural constituent of nuclear pore	IMP	molecular function
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IMP	biological process
GO:1990841	promoter-specific chromatin binding	IMP	molecular function
GO:1990904	ribonucleoprotein complex	IMP	cellular component
GO:0003729	mRNA binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003713	transcription coactivator activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0017056	structural constituent of nuclear pore	IEA	molecular function
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005215	transporter activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0008139	nuclear localization sequence binding	IEA	molecular function
GO:0034399	nuclear periphery	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0031965	nuclear membrane	IEA	cellular component
GO:0042277	peptide binding	IEA	molecular function
GO:0042405	nuclear inclusion body	IEA	cellular component
GO:0044615	nuclear pore nuclear basket	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005643	nuclear pore	IDA	cellular component
GO:0017056	structural constituent of nuclear pore	NAS	molecular function
GO:0005643	nuclear pore	NAS	cellular component
GO:0006999	nuclear pore organization	NAS	biological process
GO:0006913	nucleocytoplasmic transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05164	Influenza A

Diseases

Associated diseases	References
Acute T cell leukemia	PMID:10477737
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881