• Gene id: 4926

Gene Summary

• Gene Symbol: NUMA1   Gene   UCSC   Ensembl
• Aliases: NMP-22, NUMA
• Gene name: nuclear mitotic apparatus protein 1
• Alternate names: nuclear mitotic apparatus protein 1, SP-H antigen, centrophilin stabilizes mitotic spindle in mitotic cells, nuclear matrix protein-22, structural nuclear protein,
• Gene location: 11q13.4 (72080692: 72002863)     Exons: 38     NC_000011.10
• Gene summary(Entrez): This gene encodes a large protein that forms a structural component of the nuclear matrix. The encoded protein interacts with microtubules and plays a role in the formation and organization of the mitotic spindle during cell division. Chromosomal transloc
• OMIM: 164009

Protein Summary

• Protein general information: Q14980  
  • Name: Nuclear mitotic apparatus protein 1 (Nuclear matrix protein 22) (NMP 22) (Nuclear mitotic apparatus protein) (NuMA protein) (SP H antigen)
  • Length: 2115  
  • Mass: 238260
• Sequence:

  MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHP
  SSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENF
  LQKAPVPSTCSSTFPEELSPPSHQAKREIRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLAD
  ERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQ
  DLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQAQLEKELSAALQDKKC
  LEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQEAATLAANNTQLQARVEMLETERGQQEAKL
  LAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLK
  QQAKEKQAQLAQTLQQQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERD
  AALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQAQVAE
  LELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAADALEEQQRCISELKAETRSLVEQH
  KRERKELEEERAGRKGLEARLQQLGEAHQAETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEA
  QYGAMFQEQLMTLKEECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLAD
  DLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQFCSTQAALQAMEREAE
  QMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADLALEKAARAELEMRLQNALNEQRVEFATLQE
  ALAHALTEKEGKDQELAKLRGLEAAQIKELEELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEAL
  RAEVSKLEQQCQKQQEQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQ
  DHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESEKSQKLEERLRLLQAE
  TASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAERAEELGQELKAWQEKFFQKEQALSTLQLEH
  TSTQALVSELLPAKHLCQQLQAEQAAAEKRHREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQ
  LRAEKASYAEQLSMLKKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQS
  TARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLADSDQASKVQQQKLKAV
  QAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTHYDAKKQQNQELQEQLRSLEQLQKENKELRA
  EAERLGHELQQAGLKTKEAEQTCRHLTAQVRSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSL
  DLSCEEGTPLSITSKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDS
  GRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLPG
  YRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGT
  ITDEEMKTGDPQETLRRASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQ
  STTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATA
  AAIGATPRAKGKAKH

• Structural information:
  • Interpro: IPR026650  
  • PDB: 3RO2 5GXW 6HC2
  • PDBsum: 3RO2 5GXW 6HC2
  • DIP: 32937
  • STRING: ENSP00000377298
• Other Databases: GeneCards:  NUMA1  Malacards:  NUMA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000132	establishment of mitotic spindle orientation	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0000922	spindle pole	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0061673	mitotic spindle astral microtubule	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0019897	extrinsic component of plasma membrane	IDA	cellular component
GO:0061673	mitotic spindle astral microtubule	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0061673	mitotic spindle astral microtubule	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0031616	spindle pole centrosome	IDA	cellular component
GO:0061673	mitotic spindle astral microtubule	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0016363	nuclear matrix	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0015631	tubulin binding	IDA	molecular function
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0008017	microtubule binding	IDA	molecular function
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0019897	extrinsic component of plasma membrane	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0061673	mitotic spindle astral microtubule	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0070840	dynein complex binding	IDA	molecular function
GO:1905720	cytoplasmic microtubule bundle	IDA	cellular component
GO:0030953	astral microtubule organization	IDA	biological process
GO:0070840	dynein complex binding	IDA	molecular function
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0070840	dynein complex binding	IDA	molecular function
GO:0070840	dynein complex binding	IDA	molecular function
GO:0072686	mitotic spindle	IDA	cellular component
GO:1902365	positive regulation of protein localization to spindle pole body	IDA	biological process
GO:0097427	microtubule bundle	IDA	cellular component
GO:0070840	dynein complex binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0060236	regulation of mitotic spindle organization	IDA	biological process
GO:0051011	microtubule minus-end binding	IDA	molecular function
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0035371	microtubule plus-end	IDA	cellular component
GO:0036449	microtubule minus-end	IDA	cellular component
GO:0055028	cortical microtubule	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0097431	mitotic spindle pole	IMP	cellular component
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0032388	positive regulation of intracellular transport	IMP	biological process
GO:0090235	regulation of metaphase plate congression	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0051798	positive regulation of hair follicle development	ISS	biological process
GO:0045618	positive regulation of keratinocyte differentiation	ISS	biological process
GO:0030513	positive regulation of BMP signaling pathway	ISS	biological process
GO:0000132	establishment of mitotic spindle orientation	ISS	biological process
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001578	microtubule bundle formation	IMP	biological process
GO:0030953	astral microtubule organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902846	positive regulation of mitotic spindle elongation	IMP	biological process
GO:1905820	positive regulation of chromosome separation	IMP	biological process
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0055048	anastral spindle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0097575	lateral cell cortex	ISS	cellular component
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1905832	positive regulation of spindle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051984	positive regulation of chromosome segregation	IMP	biological process
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0007059	chromosome segregation	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005198	structural molecule activity	TAS	molecular function
GO:0005819	spindle	TAS	cellular component
GO:0006997	nucleus organization	TAS	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0099738	cell cortex region	IEA	cellular component
GO:0097431	mitotic spindle pole	IEA	cellular component
GO:0051798	positive regulation of hair follicle development	IEA	biological process
GO:0045618	positive regulation of keratinocyte differentiation	IEA	biological process
GO:0030513	positive regulation of BMP signaling pathway	IEA	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0000132	establishment of mitotic spindle orientation	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005876	spindle microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0097575	lateral cell cortex	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IMP	cellular component
GO:0097718	disordered domain specific binding	IMP	molecular function
GO:0008022	protein C-terminus binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005876	spindle microtubule	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq