• Gene id: 4923

Gene Summary

• Gene Symbol: NTSR1   Gene   UCSC   Ensembl
• Aliases: NTR
• Gene name: neurotensin receptor 1
• Alternate names: neurotensin receptor type 1, NT-R-1, NTR1, NTRH, high-affinity levocabastine-insensitive neurotensin receptor, neurotensin receptor 1 (high affinity),
• Gene location: 20q13.33 (62708769: 62762770)     Exons: 4     NC_000020.11
• Gene summary(Entrez): Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia, antinociception, and regulation of intestinal motility and secre
• OMIM: 601323

Protein Summary

• Protein general information: P30989  
  • Name: Neurotensin receptor type 1 (NT R 1) (NTR1) (High affinity levocabastine insensitive neurotensin receptor) (NTRH)
  • Length: 418  
  • Mass: 46259
  • Tissue specificity: Expressed in prostate (at protein level). Detected in colon and peripheral blood mononuclear cells. Detected at very low levels in brain. {ECO
• Sequence:

  MRLNSSAPGTPGTPAADPFQRAQAGLEEALLAPGFGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFV
  VGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLALSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDA
  CTYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCT
  PTIHTATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMAIEPGRVQALRH
  GVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVTNALFYVSSTINPILYNLVSANFRHIF
  LATLACLCPVWRRRRKRPAFSRKADSVSSNHTLSSNATRETLY

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003985  IPR003984  
  • Prosite: PS00237 PS50262
  • PDB: 2LYW 6OS9 6OSA 6PWC
  • PDBsum: 2LYW 6OS9 6OSA 6PWC
  • DIP: 60977
  • STRING: ENSP00000359532
• Other Databases: GeneCards:  NTSR1  Malacards:  NTSR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016492	G protein-coupled neurotensin receptor activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0016492	G protein-coupled neurotensin receptor activity	IMP	molecular function
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0016492	G protein-coupled neurotensin receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098712	L-glutamate import across plasma membrane	IEA	biological process
GO:0071545	inositol phosphate catabolic process	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0044309	neuron spine	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0032280	symmetric synapse	IEA	cellular component
GO:0014054	positive regulation of gamma-aminobutyric acid secretion	IEA	biological process
GO:0014049	positive regulation of glutamate secretion	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007612	learning	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003254	regulation of membrane depolarization	IEA	biological process
GO:0001659	temperature homeostasis	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:2001259	positive regulation of cation channel activity	IEA	biological process
GO:0098900	regulation of action potential	IEA	biological process
GO:0097151	positive regulation of inhibitory postsynaptic potential	IEA	biological process
GO:0090238	positive regulation of arachidonic acid secretion	IEA	biological process
GO:0070779	D-aspartate import across plasma membrane	IEA	biological process
GO:0060732	positive regulation of inositol phosphate biosynthetic process	IEA	biological process
GO:0051280	negative regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0043576	regulation of respiratory gaseous exchange	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0033993	response to lipid	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003085	negative regulation of systemic arterial blood pressure	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04020	Calcium signaling pathway

Diseases

Associated diseases	References
Parkinson's disease	PMID:7700529
Schizophrenia	PMID:11032391
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq