• Gene id: 4922

Gene Summary

• Gene Symbol: NTS   Gene   UCSC   Ensembl
• Aliases: NMN-125, NN, NT, NT/N, NTS1
• Gene name: neurotensin
• Alternate names: neurotensin/neuromedin N, pro-neurotensin/neuromedin,
• Gene location: 12q21.31 (85874294: 85882991)     Exons: 4     NC_000012.12
• Gene summary(Entrez): This gene encodes a common precursor for two peptides, neuromedin N and neurotensin. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. I
• OMIM: 162650

Protein Summary

• Protein general information: P30990  
  • Name: Neurotensin/neuromedin N [Cleaved into: Large neuromedin N (NmN 125); Neuromedin N (NN) (NmN); Neurotensin (NT); Tail peptide]
  • Length: 170  
  • Mass: 19795
• Sequence:

  MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEET
  GEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKR
  QLYENKPRRPYILKRDSYYY

• Structural information:
  • Interpro: IPR008055  
  • PDB: 2LNE 2LNF 2LNG 2LYW 2OYV 2OYW 3F6K 4PO7 5LUZ
  • PDBsum: 2LNE 2LNF 2LNG 2LYW 2OYV 2OYW 3F6K 4PO7 5LUZ
  • DIP: 60978
  • STRING: ENSP00000256010
• Other Databases: GeneCards:  NTS  Malacards:  NTS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043679	axon terminus	IBA	cellular component
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0048018	receptor ligand activity	IDA	molecular function
GO:0007218	neuropeptide signaling pathway	IDA	biological process
GO:0071855	neuropeptide receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)