• Gene id: 4920

Gene Summary

• Gene Symbol: ROR2   Gene   UCSC   Ensembl
• Aliases: BDB, BDB1, NTRKR2
• Gene name: receptor tyrosine kinase like orphan receptor 2
• Alternate names: tyrosine-protein kinase transmembrane receptor ROR2, neurotrophic tyrosine kinase receptor-related 2,
• Gene location: 9q22.31 (91950227: 91722597)     Exons: 13     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be require
• OMIM: 162651

Protein Summary

• Protein general information: Q01974  
  • Name: Tyrosine protein kinase transmembrane receptor ROR2 (EC 2.7.10.1) (Neurotrophic tyrosine kinase, receptor related 2)
  • Length: 943  
  • Mass: 104757
• Sequence:

  MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQ
  GQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVL
  FVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQ
  FAIPSFCHFVFPLCDARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
  MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGP
  WCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQRRQLMASPSQ
  DMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEA
  MLRARLQHPNVVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
  AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDI
  WSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWG
  NLSNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQ
  PVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
  PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

• Structural information:
  • Protein Domains: (55..14-)
    (/note="Ig-like-C2-type)
    (169..30-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090-)
    (316..39-)
    (/note="Kringle-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00121-)
    (473..74-)
    (/note="Protein-kinase)
    (/ev-)
  • Interpro: IPR020067  IPR036790  IPR007110  IPR036179  IPR013783   IPR013098  IPR003599  IPR003598  IPR011009  IPR000001  IPR013806  IPR018056  IPR038178  IPR000719  IPR001245  IPR008266  IPR016247  
  • Prosite: PS50038 PS50835 PS00021 PS50070 PS50011 PS00109
  • CDD: cd00108
  • PDB: 3ZZW 4GT4
  • PDBsum: 3ZZW 4GT4
  • STRING: ENSP00000364860
• Other Databases: GeneCards:  ROR2  Malacards:  ROR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway	TAS	molecular function
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	NOT|biological process
GO:0048856	anatomical structure development	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0010976	positive regulation of neuron projection development	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IPI	molecular function
GO:0001501	skeletal system development	IEA	biological process
GO:0007254	JNK cascade	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030539	male genitalia development	IEA	biological process
GO:0045651	positive regulation of macrophage differentiation	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:1905517	macrophage migration	IEA	biological process
GO:0001502	cartilage condensation	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0005109	frizzled binding	IEA	molecular function
GO:0007223	Wnt signaling pathway, calcium modulating pathway	IEA	biological process
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030538	embryonic genitalia morphogenesis	IEA	biological process
GO:0031435	mitogen-activated protein kinase kinase kinase binding	IEA	molecular function
GO:0042733	embryonic digit morphogenesis	IEA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0030282	bone mineralization	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:1900020	positive regulation of protein kinase C activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0017147	Wnt-protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Brachydactyly	KEGG:H00482
Robinow syndrome	KEGG:H00485
Brachydactyly	KEGG:H00482
Robinow syndrome	KEGG:H00485
Robinow syndrome	PMID:24932600
Brachydactyly	PMID:19461659
cleft palate	PMID:22490406
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq