• Gene id: 4915

Gene Summary

• Gene Symbol: NTRK2   Gene   UCSC   Ensembl
• Aliases: EIEE58, GP145-TrkB, OBHD, TRKB, trk-B
• Gene name: neurotrophic receptor tyrosine kinase 2
• Alternate names: BDNF/NT-3 growth factors receptor, BDNF-tropomyosine receptor kinase B, neurotrophic tyrosine kinase receptor type 2, tropomyosin-related kinase B, tyrosine kinase receptor B,
• Gene location: 9q21.33 (84668457: 85027069)     Exons: 28     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to
• OMIM: 600456

Protein Summary

• Protein general information: Q16620  
  • Name: BDNF/NT 3 growth factors receptor (EC 2.7.10.1) (GP145 TrkB) (Trk B) (Neurotrophic tyrosine kinase receptor type 2) (TrkB tyrosine kinase) (Tropomyosin related kinase B)
  • Length: 822  
  • Mass: 91999
  • Tissue specificity: Isoform TrkB is expressed in the central and peripheral nervous system. In the central nervous system (CNS), expression is observed in the cerebral cortex, hippocampus, thalamus, choroid plexus, granular layer of the cerebellum, brain
• Sequence:

  MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIAN
  QKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPF
  TCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPV
  PNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
  WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYTLIAKNEYGKDEKQIS
  AHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTDVTDKTGREHLSVYAVVVIASVVGFCLLVM
  LFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLK
  PDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHI
  VKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHR
  DLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYG
  KQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG

• Structural information:
  • Protein Domains: (32..6-)
    (/note="LRRNT-)
    (148..19-)
    (/note="LRRCT-)
    (197..28-)
    1 (/note="Ig-like-C2-type)
    (295..36-)
    2 (/note="Ig-like-C2-type)
    (538..80-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR011009  IPR001611  IPR032675  IPR000372  IPR031635  IPR000719  IPR017441  IPR001245  IPR020455  IPR008266  IPR020635  IPR020777  IPR002011  
  • Prosite: PS50835 PS00107 PS50011 PS00109 PS00239
  • PDB: 1HCF 1WWB 2MFQ 4ASZ 4AT3 4AT4 4AT5 5MO9
  • PDBsum: 1HCF 1WWB 2MFQ 4ASZ 4AT3 4AT4 4AT5 5MO9
  • DIP: 5720
  • STRING: ENSP00000277120
• Other Databases: GeneCards:  NTRK2  Malacards:  NTRK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002020	protease binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0014069	postsynaptic density	ISS	cellular component
GO:1902430	negative regulation of amyloid-beta formation	IGI	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0043121	neurotrophin binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0043408	regulation of MAPK cascade	IBA	biological process
GO:0048403	brain-derived neurotrophic factor binding	IBA	molecular function
GO:1990090	cellular response to nerve growth factor stimulus	IBA	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	IBA	biological process
GO:0005030	neurotrophin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0010976	positive regulation of neuron projection development	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0043679	axon terminus	IBA	cellular component
GO:0051896	regulation of protein kinase B signaling	IBA	biological process
GO:0060175	brain-derived neurotrophic factor-activated receptor activity	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	NOT|biological process
GO:0099551	trans-synaptic signaling by neuropeptide, modulating synaptic transmission	IBA	biological process
GO:0043121	neurotrophin binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0050772	positive regulation of axonogenesis	ISS	biological process
GO:0048403	brain-derived neurotrophic factor binding	ISS	molecular function
GO:0048403	brain-derived neurotrophic factor binding	ISS	molecular function
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0043121	neurotrophin binding	ISS	molecular function
GO:0043121	neurotrophin binding	ISS	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0001764	neuron migration	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0060175	brain-derived neurotrophic factor-activated receptor activity	IMP	molecular function
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:0043087	regulation of GTPase activity	ISS	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	IMP	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0021987	cerebral cortex development	ISS	biological process
GO:0021954	central nervous system neuron development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0007612	learning	ISS	biological process
GO:0005769	early endosome	ISS	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005030	neurotrophin receptor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:1903997	positive regulation of non-membrane spanning protein tyrosine kinase activity	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0060291	long-term synaptic potentiation	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0048403	brain-derived neurotrophic factor binding	IEA	molecular function
GO:0046548	retinal rod cell development	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0043121	neurotrophin binding	IEA	molecular function
GO:0042490	mechanoreceptor differentiation	IEA	biological process
GO:0019227	neuronal action potential propagation	IEA	biological process
GO:0019222	regulation of metabolic process	IEA	biological process
GO:0014047	glutamate secretion	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0001570	vasculogenesis	IEA	biological process
GO:2000811	negative regulation of anoikis	IEA	biological process
GO:0099551	trans-synaptic signaling by neuropeptide, modulating synaptic transmission	IEA	biological process
GO:0099183	trans-synaptic signaling by BDNF, modulating synaptic transmission	IEA	biological process
GO:0060175	brain-derived neurotrophic factor-activated receptor activity	IEA	molecular function
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0051896	regulation of protein kinase B signaling	IEA	biological process
GO:0048935	peripheral nervous system neuron development	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0022011	myelination in peripheral nervous system	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0021954	central nervous system neuron development	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0007612	learning	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0031547	brain-derived neurotrophic factor receptor signaling pathway	TAS	biological process
GO:0001934	positive regulation of protein phosphorylation	TAS	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa05034	Alcoholism
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Neuroblastoma	KEGG:H00043
Early infantile epileptic encephalopathy	KEGG:H00606
Neuroblastoma	KEGG:H00043
Idiopathic pulmonary fibrosis	PMID:21330466
Alzheimer's disease	PMID:18780967
morbid obesity	PMID:16702999
autistic disorder	PMID:20662941
Major depressive disorder	PMID:21223646
Major depressive disorder	PMID:20124106
Bipolar disorder	PMID:21612826
Schizophrenia	PMID:21223646
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq