• Gene id: 4914

Gene Summary

• Gene Symbol: NTRK1   Gene   UCSC   Ensembl
• Aliases: MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA
• Gene name: neurotrophic receptor tyrosine kinase 1
• Alternate names: high affinity nerve growth factor receptor, Oncogene TRK, TRK1-transforming tyrosine kinase protein, gp140trk, neurotrophic tyrosine kinase, receptor, type 1, tropomyosin-related kinase A, tyrosine kinase receptor A,
• Gene location: 1q23.1 (156815749: 156881849)     Exons: 19     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to ce
• OMIM: 191315

Protein Summary

• Protein general information: P04629  
  • Name: High affinity nerve growth factor receptor (EC 2.7.10.1) (Neurotrophic tyrosine kinase receptor type 1) (TRK1 transforming tyrosine kinase protein) (Tropomyosin related kinase A) (Tyrosine kinase receptor) (Tyrosine kinase receptor A) (Trk A) (gp140trk) (
  • Length: 796  
  • Mass: 87,497
• Sequence:

  MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIEN
  QQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPL
  HCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQA
  GWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
  IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIM
  AAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGI
  NRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVF
  LAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
  LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDI
  YSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPR
  ACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG

• Structural information:
  • Protein Domains: LRRCT (148-193)
    Ig-like (194-283)
    Ig-like (299-365)
    Protein (510-781)
  • Interpro: IPR000483  IPR007110  IPR036179  IPR013783  IPR011009   IPR001611  IPR032675  IPR031635  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  IPR020461  IPR020777  IPR002011  
  • Prosite: PS50835 PS00107 PS50011 PS00109 PS00239
  • PDB: 1HE7 1SHC 1WWA 1WWW 2IFG 2N90 4AOJ 4CRP 4F0I 4GT5 4PMM 4PMP 4PMS 4PMT 4YNE 4YPS 5H3Q 5I8A 5JFS 5JFV 5JFW 5JFX 5KMI 5KMJ 5KMK 5KML 5KMM 5KMN 5KMO 5KVT 5WR7
  • PDBsum: 1HE7 1SHC 1WWA 1WWW 2IFG 2N90 4AOJ 4CRP 4F0I 4GT5 4PMM 4PMP 4PMS 4PMT 4YNE 4YPS 5H3Q 5I8A 5JFS 5JFV 5JFW 5JFX 5KMI 5KMJ 5KMK 5KML 5KMM 5KMN 5KMO 5KVT 5WR7
  • DIP: 5714
  • STRING: ENSP00000431418
• Other Databases: GeneCards:  NTRK1  Malacards:  NTRK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0001934	positive regulation of protein phosphorylation	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0005004	GPI-linked ephrin receptor activity	IEA	molecular function
GO:0005166	neurotrophin p75 receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010465	nerve growth factor receptor activity	IDA	molecular function
GO:0010623	programmed cell death involved in cell development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0021553	olfactory nerve development	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0038180	nerve growth factor signaling pathway	IEA	biological process
GO:0042490	mechanoreceptor differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043068	positive regulation of programmed cell death	ISS	biological process
GO:0043121	neurotrophin binding	TAS	molecular function
GO:0043234	protein complex	ISS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048485	sympathetic nervous system development	ISS	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051599	response to hydrostatic pressure	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060009	Sertoli cell development	IEA	biological process
GO:0060385	axonogenesis involved in innervation	ISS	biological process
GO:0061368	behavioral response to formalin induced pain	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0071316	cellular response to nicotine	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	TAS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0005004	GPI-linked ephrin receptor activity	IEA	molecular function
GO:0005030	neurotrophin receptor activity	IEA	molecular function
GO:0005166	neurotrophin p75 receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010465	nerve growth factor receptor activity	IDA	molecular function
GO:0010623	programmed cell death involved in cell development	IEA	biological process
GO:0010623	programmed cell death involved in cell development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0019233	sensory perception of pain	IEA	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0021553	olfactory nerve development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0035094	response to nicotine	IEA	biological process
GO:0038180	nerve growth factor signaling pathway	IEA	biological process
GO:0042490	mechanoreceptor differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043068	positive regulation of programmed cell death	IEA	biological process
GO:0043068	positive regulation of programmed cell death	ISS	biological process
GO:0043121	neurotrophin binding	TAS	molecular function
GO:0043234	protein complex	IEA	cellular component
GO:0043234	protein complex	ISS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048406	nerve growth factor binding	IEA	molecular function
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048485	sympathetic nervous system development	IEA	biological process
GO:0048485	sympathetic nervous system development	ISS	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051599	response to hydrostatic pressure	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0051968	positive regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0060009	Sertoli cell development	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0060385	axonogenesis involved in innervation	IEA	biological process
GO:0060385	axonogenesis involved in innervation	ISS	biological process
GO:0061368	behavioral response to formalin induced pain	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0071316	cellular response to nicotine	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0000186	activation of MAPKK activity	TAS	biological process
GO:0001934	positive regulation of protein phosphorylation	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005768	endosome	TAS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0010465	nerve growth factor receptor activity	IDA	molecular function
GO:0010623	programmed cell death involved in cell development	ISS	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043068	positive regulation of programmed cell death	ISS	biological process
GO:0043121	neurotrophin binding	TAS	molecular function
GO:0043234	protein complex	ISS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IDA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0048485	sympathetic nervous system development	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0060385	axonogenesis involved in innervation	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	ISS	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0048406	nerve growth factor binding	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04210	Apoptosis
hsa04722	Neurotrophin signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05230	Central carbon metabolism in cancer
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Neuroblastoma	KEGG: H00043
Cancer (thyroid)	KEGG: H00032
Cancer (medullary thyroid)	OMIM: 191315
Cancer	GAD: 20003389
Cancer (leukemia)	GAD: 18270328
Cancer (Neuroblastoma)	GAD: 20003389
Cancer (thyroid)	GAD: 19730683
Hyperparathyroidism	GAD: 20424473
Thyroid diseases	GAD: 21134548
Diabetes	GAD: 17261673
Bone diseases	GAD: 19453261
Hereditary sensory and autonomic neuropathies	GAD: 19651702
Psychological disorders	GAD: 19086053
Several psychiatric disorders	GAD: 19086053
Autism	GAD: 19598235
Alzheimer's disease	GAD: 18780967
Oligoasthenozoospermia	MIK: 20542022
Asthenozoospermia	MIK: 20542022
Female infertility	INFBASE: 21645891
Chronic renal failure	GAD: 21085059
Associated with testis development and events such as seminiferous cord formation	MIK: 12021070
Cryptorchidism	MIK: 28606200
Oligoasthenozoospermia	MIK: 20542022
Asthenozoospermia	MIK: 20542022
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20542022	Oligoasthenozoospermic, asthenozoospermic				Male infertility	TrkA
12021070	Associated with testis development and events such as seminiferous cord formation				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq