• Gene id: 4909

Gene Summary

• Gene Symbol: NTF4   Gene   UCSC   Ensembl
• Aliases: GLC10, GLC1O, NT-4, NT-4/5, NT-5, NT4, NT5, NTF5
• Gene name: neurotrophin 4
• Alternate names: neurotrophin-4, neurotrophic factor 4, neurotrophic factor 5, neurotrophin 5 (neurotrophin 4/5), neurotrophin-5, neutrophic factor 4,
• Gene location: 19q13.33 (172532348: 172611832)     Exons: 26     NC_000001.11
• Gene summary(Entrez): This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neu
• OMIM: 162662

Protein Summary

• Protein general information: P34130  
  • Name: Neurotrophin 4 (NT 4) (Neurotrophin 5) (NT 5) (Neutrophic factor 4)
  • Length: 210  
  • Mass: 22427
  • Tissue specificity: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues.
• Sequence:

  MLPLPSCSLPILLLFLLPSVPIESQPPPSTLPPFLAPEWDLLSPRVVLSRGAPAGPPLLFLLEAGAFRESAGAPA
  NRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGG
  PGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA

• Structural information:
  • Interpro: IPR029034  IPR020408  IPR002072  IPR019846  IPR020432  
  • Prosite: PS00248 PS50270
  • PDB: 1B8M 1B98 1HCF
  • PDBsum: 1B8M 1B98 1HCF
  • STRING: ENSP00000469455
• Other Databases: GeneCards:  NTF4  Malacards:  NTF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0007613	memory	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005163	nerve growth factor receptor binding	IBA	molecular function
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0038180	nerve growth factor signaling pathway	IBA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IBA	biological process
GO:0021675	nerve development	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0007422	peripheral nervous system development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0048011	neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007202	activation of phospholipase C activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0042490	mechanoreceptor differentiation	IEA	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0007616	long-term memory	IEA	biological process
GO:0061193	taste bud development	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0008052	sensory organ boundary specification	IEA	biological process
GO:0007402	ganglion mother cell fate determination	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007616	long-term memory	ISS	biological process
GO:0007402	ganglion mother cell fate determination	ISS	biological process
GO:0008544	epidermis development	ISS	biological process
GO:0008344	adult locomotory behavior	ISS	biological process
GO:0008052	sensory organ boundary specification	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Primary open angle glaucoma	KEGG:H00612
Primary open angle glaucoma	KEGG:H00612
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray