• Gene id: 4908

Gene Summary

• Gene Symbol: NTF3   Gene   UCSC   Ensembl
• Aliases: HDNF, NGF-2, NGF2, NT-3, NT3
• Gene name: neurotrophin 3
• Alternate names: neurotrophin-3, nerve growth factor 2, neurotrophic factor,
• Gene location: 12p13.31 (5432107: 5495298)     Exons: 3     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the neurotrophin family, that controls survival and differentiation of mammalian neurons. This protein is closely related to both nerve growth factor and brain-derived neurotrophic factor. It may be involved
• OMIM: 156349

Protein Summary

• Protein general information: P20783  
  • Name: Neurotrophin 3 (NT 3) (HDNF) (Nerve growth factor 2) (NGF 2) (Neurotrophic factor)
  • Length: 257  
  • Mass: 29355
  • Tissue specificity: Brain and peripheral tissues.
• Sequence:

  MSILFYVIFLAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERG
  GPAKSAFQPVIAMDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLMEDYVGSPVVANRTSRRKRYAEHKSHRGEYS
  VCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVR
  ALTSENNKLVGWRWIRIDTSCVCALSRKIGRT

• Structural information:
  • Interpro: IPR029034  IPR020408  IPR002072  IPR019846  IPR015578  
  • Prosite: PS00248 PS50270
  • PDB: 1B8K 1BND 1NT3 3BUK
  • PDBsum: 1B8K 1BND 1NT3 3BUK
  • DIP: 346
  • STRING: ENSP00000397297
• Other Databases: GeneCards:  NTF3  Malacards:  NTF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005163	nerve growth factor receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0007613	memory	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0007422	peripheral nervous system development	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0021675	nerve development	IBA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IBA	biological process
GO:0038180	nerve growth factor signaling pathway	IBA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0005165	neurotrophin receptor binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0042981	regulation of apoptotic process	IGI	biological process
GO:0051388	positive regulation of neurotrophin TRK receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0010863	positive regulation of phospholipase C activity	TAS	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0002092	positive regulation of receptor internalization	IDA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IDA	biological process
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050930	induction of positive chemotaxis	IDA	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9502217
Hydrocephalus	PMID:11580868
pulmonary sarcoidosis	PMID:21059230
pulmonary sarcoidosis	PMID:16315781
Asthma	PMID:11737043
Chronic obstructive pulmonary disease	PMID:15843147
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq