• Gene id: 4907

Gene Summary

• Gene Symbol: NT5E   Gene   UCSC   Ensembl
• Aliases: CALJA, CD73, E5NT, NT, NT5, NTE, eN, eNT
• Gene name: 5'-nucleotidase ecto
• Alternate names: 5'-nucleotidase, 5'-NT, Purine 5-Prime-Nucleotidase, ecto-5'-nucleotidase,
• Gene location: 6q14.3 (85449583: 85495790)     Exons: 9     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene ca
• OMIM: 129190

Protein Summary

• Protein general information: P21589  
  • Name: 5' nucleotidase (5' NT) (EC 3.1.3.5) (Ecto 5' nucleotidase) (CD antigen CD73)
  • Length: 574  
  • Mass: 63368
• Sequence:

  MCPRAARAPATLLLALGAVLWPAAGAWELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAE
  PNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPL
  ASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEM
  DKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKIEFDERGNV
  ISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRH
  TDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFL
  QVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDI
  NVVSTYISKMKVIYPAVEGRIKFSTGSHCHGSFSLIFLSLWAVIFVLYQ

• Structural information:
  • Interpro: IPR008334  IPR036907  IPR006146  IPR006179  IPR004843   IPR029052  
  • Prosite: PS00785 PS00786
  • PDB: 4H1S 4H1Y 4H2B 4H2F 4H2G 4H2I 6HXW
  • PDBsum: 4H1S 4H1Y 4H2B 4H2F 4H2G 4H2I 6HXW
  • DIP: 59992
  • STRING: ENSP00000257770
• Other Databases: GeneCards:  NT5E  Malacards:  NT5E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008253	5'-nucleotidase activity	IDA	molecular function
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006196	AMP catabolic process	IBA	biological process
GO:0008253	5'-nucleotidase activity	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016788	hydrolase activity, acting on ester bonds	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0009166	nucleotide catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0008253	5'-nucleotidase activity	TAS	molecular function
GO:0006259	DNA metabolic process	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0008253	5'-nucleotidase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0046135	pyrimidine nucleoside catabolic process	TAS	biological process
GO:0019674	NAD metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008253	5'-nucleotidase activity	IEA	molecular function
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0046086	adenosine biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006196	AMP catabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0009986	cell surface	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00240	Pyrimidine metabolism
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
Calcification of joints and arteries	KEGG:H00824
Calcification of joints and arteries	KEGG:H00824
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)