• Gene id: 4904

Gene Summary

• Gene Symbol: YBX1   Gene   UCSC   Ensembl
• Aliases: BP-8, CBF-A, CSDA2, CSDB, DBPB, EFI-A, MDR-NF1, NSEP-1, NSEP1, YB-1, YB1
• Gene name: Y-box binding protein 1
• Alternate names: Y-box-binding protein 1, CCAAT-binding transcription factor I subunit A, DNA-binding protein B, Y-box transcription factor, enhancer factor I subunit A, major histocompatibility complex, class II, Y box-binding protein I, nuclease-sensitive element-binding prot,
• Gene location: 1p34.2 (42682417: 42703804)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation
• OMIM: 154030

Protein Summary

• Protein general information: P67809  
  • Name: Y box binding protein 1 (YB 1) (CCAAT binding transcription factor I subunit A) (CBF A) (DNA binding protein B) (DBPB) (Enhancer factor I subunit A) (EFI A) (Nuclease sensitive element binding protein 1) (Y box transcription factor)
  • Length: 324  
  • Mass: 35924
• Sequence:

  MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFI
  NRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPR
  RRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQG
  AGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
  KETKAADPPAENSSAPEAEQGGAE

• Structural information:
  • Protein Domains: (61..12-)
    (/note="CSD"-)
  • Interpro: IPR011129  IPR019844  IPR002059  IPR012340  
  • Prosite: PS00352 PS51857
  • CDD: cd04458
  • PDB: 1H95 5YTS 5YTT 5YTV 5YTX 6A6L
  • PDBsum: 1H95 5YTS 5YTT 5YTV 5YTX 6A6L
  • DIP: 29405
  • STRING: ENSP00000361626
• Other Databases: GeneCards:  YBX1  Malacards:  YBX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1990124	messenger ribonucleoprotein complex	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IBA	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0035198	miRNA binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0048255	mRNA stabilization	IDA	biological process
GO:0062153	C5-methylcytidine-containing RNA binding	IDA	molecular function
GO:1990428	miRNA transport	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0048598	embryonic morphogenesis	ISS	biological process
GO:0017148	negative regulation of translation	ISS	biological process
GO:0008544	epidermis development	ISS	biological process
GO:0051031	tRNA transport	IMP	biological process
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000773	negative regulation of cellular senescence	ISS	biological process
GO:0050658	RNA transport	IMP	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:1903608	protein localization to cytoplasmic stress granule	IMP	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0008544	epidermis development	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051154	negative regulation of striated muscle cell differentiation	IEA	biological process
GO:0071204	histone pre-mRNA 3'end processing complex	IEA	cellular component
GO:0098761	cellular response to interleukin-7	IEA	biological process
GO:2000773	negative regulation of cellular senescence	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0070937	CRD-mediated mRNA stability complex	IDA	cellular component
GO:0070934	CRD-mediated mRNA stabilization	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray