• Gene id: 4902

Gene Summary

• Gene Symbol: NRTN   Gene   UCSC   Ensembl
• Aliases: NTN
• Gene name: neurturin
• Alternate names: neurturin, prepro-neurturin,
• Gene location: 19p13.3 (5805386: 5828323)     Exons: 3     NC_000019.10
• Gene summary(Entrez): This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine ki
• OMIM: 609484

Protein Summary

• Protein general information: Q99748  
  • Name: Neurturin
  • Length: 197  
  • Mass: 22405
• Sequence:

  MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRALLQGAPDAMELRELTP
  WAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQ
  RRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV

• Structural information:
  • Interpro: IPR029034  IPR001839  
  • Prosite: PS51362
  • PDB: 5MR4 5MR5 5MR9 5NMZ 6GL7 6Q2O 6Q2R
  • PDBsum: 5MR4 5MR5 5MR9 5NMZ 6GL7 6Q2O 6Q2R
  • STRING: ENSP00000302648
• Other Databases: GeneCards:  NRTN  Malacards:  NRTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0030116	glial cell-derived neurotrophic factor receptor binding	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0031175	neuron projection development	IDA	biological process
GO:0001755	neural crest cell migration	IDA	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030424	axon	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0021675	nerve development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Hirschsprung's disease	PMID:9700200
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881