• Gene id: 4900

Gene Summary

• Gene Symbol: NRGN   Gene   UCSC   Ensembl
• Aliases: RC3, hng
• Gene name: neurogranin
• Alternate names: neurogranin, calmodulin-binding protein, neurogranin (protein kinase C substrate, RC3), protein kinase C substrate,
• Gene location: 11q24.2 (124739941: 124747209)     Exons: 4     NC_000011.10
• Gene summary(Entrez): Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The ex
• OMIM: 602349

Protein Summary

• Protein general information: Q92686  
  • Name: Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55 78)]
  • Length: 78  
  • Mass: 7618
  • Tissue specificity: In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease. {ECO
• Sequence:

  MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGP
  SGD

• Structural information:
  • Protein Domains: (26..4-)
    (/note="IQ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00116-)
    (48..7-)
    (/note="Collagen-like"-)
  • Interpro: IPR000048  
  • Prosite: PS50096
  • STRING: ENSP00000284292
• Other Databases: GeneCards:  NRGN  Malacards:  NRGN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0070300	phosphatidic acid binding	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005516	calmodulin binding	TAS	molecular function
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0021537	telencephalon development	IEA	biological process
GO:0012510	trans-Golgi network transport vesicle membrane	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:0070300	phosphatidic acid binding	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0044327	dendritic spine head	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0008306	associative learning	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IEA	molecular function

Diseases

Associated diseases	References
Alzheimer's disease	PMID:9329454
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq