• Gene id: 4897

Gene Summary

• Gene Symbol: NRCAM   Gene   UCSC   Ensembl
• Gene name: neuronal cell adhesion molecule
• Alternate names: neuronal cell adhesion molecule, NgCAM-related cell adhesion molecule, neuronal surface protein Bravo,
• Gene location: 7q31.1 (108456719: 108147625)     Exons: 47     NC_000007.14
• Gene summary(Entrez): Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved
• OMIM: 601581

Protein Summary

• Protein general information: Q92823  
  • Name: Neuronal cell adhesion molecule (Nr CAM) (Neuronal surface protein Bravo) (hBravo) (NgCAM related cell adhesion molecule) (Ng CAM related)
  • Length: 1304  
  • Mass: 143890
  • Tissue specificity: Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
• Sequence:

  MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLEDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPP
  PSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKE
  KLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHT
  QTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP
  IIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAAPYWITAPQNLVLSPG
  EDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFSNVQERSSAVYQCNASNEYGYLLANAFVNVL
  AEPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTC
  VARNKLGMAKNEVHLEIKDPTWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDH
  LVVADVSDDDSGTYTCVANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLELTDQLDKSVQLSWTPGDDNNS
  PITKFIIEYEDAMHKPGLWHHQTEVSGTQTTAQLKLSPYVNYSFRVMAVNSIGKSLPSEASEQYLTKASEPDKNP
  TAVEGLGSEPDNLVITWKPLNGFESNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALN
  DMGFAPEPAVVMGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIE
  KKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPP
  SHPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDE
  AGILPPDVGAGKVQAVNPRISNLTAAAAETYANISWEYEGPEHVNFYVEYGVAGSKEEWRKEIVNGSRSFFGLKG
  LMPGTAYKVRVGAVGDSGFVSSEDVFETGPAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPV
  KEKEDAHADPEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQ
  YSGKKEKEPAEGNESSEAPSPVNAMNSFV

• Structural information:
  • Protein Domains: (46..13-)
    (/note="Ig-like-1)
    (141..23-)
    (/note="Ig-like-2)
    (267..35-)
    (/note="Ig-like-3)
    (361..44-)
    (/note="Ig-like-4)
    (454..54-)
    (/note="Ig-like-5)
    (545..63-)
    (/note="Ig-like-6)
    (649..74-)
    (/note="Fibronect-)
  • Interpro: IPR003961  IPR036116  IPR007110  IPR036179  IPR013783   IPR003006  IPR013098  IPR003599  IPR003598  IPR026966  
  • Prosite: PS50853 PS50835 PS00290
  • CDD: cd00063
  • PDB: 1UEN 1UEY
  • PDBsum: 1UEN 1UEY
  • STRING: ENSP00000368314
• Other Databases: GeneCards:  NRCAM  Malacards:  NRCAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0019227	neuronal action potential propagation	IEA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0007417	central nervous system development	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0086080	protein binding involved in heterotypic cell-cell adhesion	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0045162	clustering of voltage-gated sodium channels	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043194	axon initial segment	ISS	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034113	heterotypic cell-cell adhesion	IEA	biological process
GO:0045162	clustering of voltage-gated sodium channels	IDA	biological process
GO:0030506	ankyrin binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0045666	positive regulation of neuron differentiation	NAS	biological process
GO:0043005	neuron projection	NAS	cellular component
GO:0001764	neuron migration	NAS	biological process
GO:0001525	angiogenesis	IEP	biological process
GO:0030516	regulation of axon extension	NAS	biological process
GO:0009897	external side of plasma membrane	NAS	cellular component
GO:0007416	synapse assembly	TAS	biological process
GO:0007413	axonal fasciculation	NAS	biological process
GO:0007409	axonogenesis	NAS	biological process
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0007417	central nervous system development	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq