• Gene id: 489

Gene Summary

• Gene Symbol: ATP2A3   Gene   UCSC   Ensembl
• Aliases: SERCA3
• Gene name: ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
• Alternate names: sarcoplasmic/endoplasmic reticulum calcium ATPase 3, ATPase, Ca(2+)-transporting, ubiquitous, ATPase, Ca++ transporting, ubiquitous, SR Ca(2+)-ATPase 3, adenosine triphosphatase, calcium, calcium pump 3, calcium-translocating P-type ATPase, sarco/endoplasmic ret,
• Gene location: 17p13.2 (3964463: 3923868)     Exons: 25     NC_000017.11
• Gene summary(Entrez): This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
• OMIM: 604016

Protein Summary

• Protein general information: Q93084  
  • Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (SERCA3) (SR Ca(2+) ATPase 3) (EC 7.2.2.10) (Calcium pump 3)
  • Length: 1043  
  • Mass: 113977
  • Tissue specificity: Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelia
• Sequence:

  MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDLLVRILLLAALVSFVL
  AWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALKEYEPEMGKVIRSDRKGVQRIRARDIVPGDI
  VEVAVGDKVPADLRLIEIKSTTLRVDQSILTGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVA
  TGLHTELGKIRSQMAAVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
  ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVAEADAG
  SCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVE
  KMNVFDTDLQALSRVERAGACNTVIKQLMRKEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERC
  SSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML
  DPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDDLSPEQQRQACRTARC
  FARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAMGSGTAVAKSAAEMVLSDDNFASIVAAVEEG
  RAIYSNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPR
  EALISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
  LSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVTPLSGRQWVVVLQISL
  PVILLDEALKYLSRNHMHACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD

• Structural information:
  • Interpro: IPR006068  IPR004014  IPR023299  IPR018303  IPR023298   IPR008250  IPR036412  IPR023214  IPR005782  IPR001757  IPR030330  
  • Prosite: PS00154
  • STRING: ENSP00000353072
• Other Databases: GeneCards:  ATP2A3  Malacards:  ATP2A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903515	calcium ion transport from cytosol to endoplasmic reticulum	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	biological process
GO:0015085	calcium ion transmembrane transporter activity	IDA	molecular function
GO:0015085	calcium ion transmembrane transporter activity	IDA	molecular function
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0030899	calcium-dependent ATPase activity	IDA	molecular function
GO:0031090	organelle membrane	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0006874	cellular calcium ion homeostasis	IMP	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:1900121	negative regulation of receptor binding	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0033017	sarcoplasmic reticulum membrane	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0008553	proton-exporting ATPase activity, phosphorylative mechanism	IBA	molecular function
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IBA	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	TAS	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0031095	platelet dense tubular network membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006816	calcium ion transport	TAS	biological process
GO:1903515	calcium ion transport from cytosol to endoplasmic reticulum	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	biological process
GO:0015085	calcium ion transmembrane transporter activity	IDA	molecular function
GO:0015085	calcium ion transmembrane transporter activity	IDA	molecular function
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0030899	calcium-dependent ATPase activity	IDA	molecular function
GO:0031090	organelle membrane	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0006874	cellular calcium ion homeostasis	IMP	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:0070588	calcium ion transmembrane transport	IDA	biological process
GO:1900121	negative regulation of receptor binding	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0070588	calcium ion transmembrane transport	IBA	biological process
GO:0033017	sarcoplasmic reticulum membrane	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0008553	proton-exporting ATPase activity, phosphorylative mechanism	IBA	molecular function
GO:0006874	cellular calcium ion homeostasis	IBA	biological process
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IBA	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006816	calcium ion transport	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	TAS	molecular function
GO:0005388	calcium transmembrane transporter activity, phosphorylative mechanism	IEA	molecular function
GO:0031095	platelet dense tubular network membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0006816	calcium ion transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04024	cAMP signaling pathway
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa05017	Spinocerebellar ataxia
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04919	Thyroid hormone signaling pathway
hsa04260	Cardiac muscle contraction
hsa04972	Pancreatic secretion
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq