• Gene id: 4889

Gene Summary

• Gene Symbol: NPY5R   Gene   UCSC   Ensembl
• Aliases: NPY5-R, NPYR5, NPYY5-R
• Gene name: neuropeptide Y receptor Y5
• Alternate names: neuropeptide Y receptor type 5, NPY-Y5 receptor, Y5 receptor,
• Gene location: 4q32.2 (163336967: 163352276)     Exons: 7     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved

Protein Summary

• Protein general information: Q15761  
  • Name: Neuropeptide Y receptor type 5 (NPY5 R) (NPY Y5 receptor) (NPYY5 R) (Y5 receptor)
  • Length: 445  
  • Mass: 50727
  • Tissue specificity: Brain; hypothalamus.
• Sequence:

  MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTT
  VNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNN
  LTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLV
  CLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAP
  ERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILIL
  VFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000393  IPR000611  
  • Prosite: PS50262
  • CDD: cd15398
  • PDB: 2HE6
  • PDBsum: 2HE6
  • STRING: ENSP00000423917
• Other Databases: GeneCards:  NPY5R  Malacards:  NPY5R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001601	peptide YY receptor activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0001602	pancreatic polypeptide receptor activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004983	neuropeptide Y receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042755	eating behavior	IEA	biological process
GO:0014050	negative regulation of glutamate secretion	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0002675	positive regulation of acute inflammatory response	IEA	biological process
GO:0001601	peptide YY receptor activity	IEA	molecular function
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0001601	peptide YY receptor activity	IEA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0060112	generation of ovulation cycle rhythm	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0032229	negative regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0002865	negative regulation of acute inflammatory response to antigenic stimulus	IEA	biological process
GO:0001602	pancreatic polypeptide receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001602	pancreatic polypeptide receptor activity	IEA	molecular function
GO:0003151	outflow tract morphogenesis	IMP	biological process
GO:0003214	cardiac left ventricle morphogenesis	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Peripheral artery disease	PMID:21468772
Lipid metabolism disorder	PMID:17426313
obesity	PMID:10849579
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R