• Gene id: 4886

Gene Summary

• Gene Symbol: NPY1R   Gene   UCSC   Ensembl
• Aliases: NPY1-R, NPYR
• Gene name: neuropeptide Y receptor Y1
• Alternate names: neuropeptide Y receptor type 1,
• Gene location: 4q32.2 (163344831: 163323961)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene belongs to the G-protein-coupled receptor superfamily. The encoded transmembrane protein mediates the function of neuropeptide Y (NPY), a neurotransmitter, and peptide YY (PYY), a gastrointestinal hormone. The encoded receptor undergoes fast ago
• OMIM: 162641

Protein Summary

• Protein general information: P25929  
  • Name: Neuropeptide Y receptor type 1 (NPY1 R)
  • Length: 384  
  • Mass: 44392
• Sequence:

  MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVT
  NILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRP
  NNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLC
  FIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
  LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKI
  NNNDDNEKI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000351  IPR000611  
  • Prosite: PS00237 PS50262
  • PDB: 2F1U 2IIL 5ZBQ
  • PDBsum: 2F1U 2IIL 5ZBQ
  • STRING: ENSP00000354652
• Other Databases: GeneCards:  NPY1R  Malacards:  NPY1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001602	pancreatic polypeptide receptor activity	IBA	molecular function
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004983	neuropeptide Y receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0040014	regulation of multicellular organism growth	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0001601	peptide YY receptor activity	IEA	molecular function
GO:0019233	sensory perception of pain	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0001602	pancreatic polypeptide receptor activity	IEA	molecular function
GO:0003151	outflow tract morphogenesis	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Peripheral artery disease	PMID:21468772
Temporal lobe epilepsy	PMID:15337376
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)