• Gene id: 4883

Gene Summary

• Gene Symbol: NPR3   Gene   UCSC   Ensembl
• Aliases: ANP-C, ANPR-C, ANPRC, C5orf23, GUCY2B, NPR-C, NPRC
• Gene name: natriuretic peptide receptor 3
• Alternate names: atrial natriuretic peptide receptor 3, atrial natriuretic peptide clearance receptor, atrial natriuretic peptide receptor type C, atrionatriuretic peptide receptor C, guanylate cyclase C, natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic pep,
• Gene location: 5p13.3 (32689075: 32791723)     Exons: 13     NC_000005.10
• Gene summary(Entrez): This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of thi
• OMIM: 108962

Protein Summary

• Protein general information: P17342  
  • Name: Atrial natriuretic peptide receptor 3 (Atrial natriuretic peptide clearance receptor) (Atrial natriuretic peptide receptor type C) (ANP C) (ANPR C) (NPR C)
  • Length: 541  
  • Mass: 59808
• Sequence:

  MPSLLVLTFSPCVLLGWALLAGGTGGGGVGGGGGGAGIGGGRQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPA
  IEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHW
  DLPMLSAGALAAGFQHKDSEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQ
  EEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDG
  SWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEV
  LRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRPNVKY
  PWGPLKLRIDENRIVEHTNSSPCKSSGGLEESAVTGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGK
  HRELREDSIRSHFSVA

• Structural information:
  • Interpro: IPR001828  IPR001170  IPR028082  
  • Prosite: PS00458
  • PDB: 1JDN 1JDP 1YK0 1YK1
  • PDBsum: 1JDN 1JDP 1YK0 1YK1
  • STRING: ENSP00000265074
• Other Databases: GeneCards:  NPR3  Malacards:  NPR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016941	natriuretic peptide receptor activity	IDA	molecular function
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0008217	regulation of blood pressure	ISS	biological process
GO:0002158	osteoclast proliferation	ISS	biological process
GO:0001501	skeletal system development	ISS	biological process
GO:0035810	positive regulation of urine volume	ISS	biological process
GO:0033688	regulation of osteoblast proliferation	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030157	pancreatic juice secretion	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0007200	phospholipase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0008217	regulation of blood pressure	IEA	biological process
GO:0002158	osteoclast proliferation	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0016941	natriuretic peptide receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008528	G protein-coupled peptide receptor activity	IEA	molecular function
GO:0007194	negative regulation of adenylate cyclase activity	IEA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0035810	positive regulation of urine volume	IEA	biological process
GO:0033688	regulation of osteoblast proliferation	IEA	biological process
GO:0017046	peptide hormone binding	ISS	molecular function
GO:0008528	G protein-coupled peptide receptor activity	ISS	molecular function
GO:0005887	integral component of plasma membrane	IC	cellular component
GO:0051000	positive regulation of nitric-oxide synthase activity	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042562	hormone binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042277	peptide binding	IPI	molecular function
GO:0031404	chloride ion binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Hypertension	PMID:12872042
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq