• Gene id: 4882

Gene Summary

• Gene Symbol: NPR2   Gene   UCSC   Ensembl
• Aliases: AMDM, ANPRB, ANPb, ECDM, GC-B, GCB, GUC2B, GUCY2B, NPRB, NPRBi, SNSK
• Gene name: natriuretic peptide receptor 2
• Alternate names: atrial natriuretic peptide receptor 2, atrial natriuretic peptide B-type receptor, atrial natriuretic peptide receptor type B, guanylate cyclase 2B, guanylate cyclase B, natriuretic peptide receptor B/guanylate cyclase B (atrionatriuretic peptide receptor B),
• Gene location: 9p13.3 (35782085: 35809730)     Exons: 24     NC_000009.12
• Gene summary(Entrez): This gene encodes natriuretic peptide receptor B, one of two integral membrane receptors for natriuretic peptides. Both NPR1 and NPR2 contain five functional domains: an extracellular ligand-binding domain, a single membrane-spanning region, and intracell
• OMIM: 602350

Protein Summary

• Protein general information: P20594  
  • Name: Atrial natriuretic peptide receptor 2 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type B) (ANP B) (ANPR B) (NPR B) (Guanylate cyclase B) (GC B)
  • Length: 1047  
  • Mass: 117022
• Sequence:

  MALPSLLLLVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRALPVDLRFVSSELEGAC
  SEYLAPLSAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLLTAGAVASGFSAKNDHYRTLVRTGPSAPKLG
  EFVVTLHGHFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVY
  ICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQAQALREAFQTVLVITYRE
  PPNPEYQEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHG
  VTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWWTGRPIPWVKGAPPSDNPPCAFDLDDPSCDK
  TPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYG
  SLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
  RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFRSTAEPD
  DSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRP
  SIDRTQLNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLE
  EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
  DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMP
  RYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGERKGPPGLL

• Structural information:
  • Protein Domains: (513..78-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (861..99-)
    (/note="Guanylate-cyclase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00099"-)
  • Interpro: IPR001054  IPR018297  IPR001828  IPR001170  IPR011009   IPR029787  IPR028082  IPR000719  IPR001245  
  • Prosite: PS00458 PS00452 PS50125 PS50011
  • STRING: ENSP00000341083
• Other Databases: GeneCards:  NPR2  Malacards:  NPR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001653	peptide receptor activity	IBA	molecular function
GO:0004383	guanylate cyclase activity	IBA	molecular function
GO:0006182	cGMP biosynthetic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0007168	receptor guanylyl cyclase signaling pathway	IBA	biological process
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016941	natriuretic peptide receptor activity	IBA	molecular function
GO:0007168	receptor guanylyl cyclase signaling pathway	IDA	biological process
GO:0004383	guanylate cyclase activity	IDA	molecular function
GO:0016941	natriuretic peptide receptor activity	IDA	molecular function
GO:0016941	natriuretic peptide receptor activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0007168	receptor guanylyl cyclase signaling pathway	IMP	biological process
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0004383	guanylate cyclase activity	IMP	molecular function
GO:0042562	hormone binding	IPI	molecular function
GO:0016941	natriuretic peptide receptor activity	IMP	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0009190	cyclic nucleotide biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016849	phosphorus-oxygen lyase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0006182	cGMP biosynthetic process	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0010753	positive regulation of cGMP-mediated signaling	IEA	biological process
GO:0016941	natriuretic peptide receptor activity	IEA	molecular function
GO:0022414	reproductive process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0051447	negative regulation of meiotic cell cycle	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:1900194	negative regulation of oocyte maturation	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006182	cGMP biosynthetic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04022	cGMP-PKG signaling pathway
hsa00230	Purine metabolism
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction

Diseases

Associated diseases	References
Acromesomelic dysplasia, Maroteaux type	KEGG:H00470
Acromesomelic dysplasia, Maroteaux type	KEGG:H00470
Essential hypertension	PMID:10082481
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray