• Gene id: 4881

Gene Summary

• Gene Symbol: NPR1   Gene   UCSC   Ensembl
• Aliases: ANPRA, ANPa, GUC2A, GUCY2A, NPRA
• Gene name: natriuretic peptide receptor 1
• Alternate names: atrial natriuretic peptide receptor 1, ANP-A, ANPR-A, GC-A, NPR-A, atrial natriuretic peptide receptor type A, atrionatriuretic peptide receptor A, guanylate cyclase A, natriuretic peptide A type receptor, natriuretic peptide receptor A, natriuretic peptide recepto,
• Gene location: 1q21.3 (153678648: 153693991)     Exons: 22     NC_000001.11
• Gene summary(Entrez): Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surfac
• OMIM: 139255

Protein Summary

• Protein general information: P16066  
  • Name: Atrial natriuretic peptide receptor 1 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type A) (ANP A) (ANPR A) (NPR A) (Guanylate cyclase A) (GC A)
  • Length: 1061  
  • Mass: 118919
• Sequence:

  MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVELALAQVKARPDLLPG
  WTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPVGRFTAHWRVPLLTAGAPALGFGVKD
  EYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDL
  SHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
  SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVT
  DGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNWPLGYPPP
  DIPKCGFDNEDPACNQDHLSTLEVLALVGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLR
  SAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
  ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLK
  ITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKE
  IIERVTRGEQPPFRPSLALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYAN
  NLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
  LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGI
  HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYW
  LLGERGSSTRG

• Structural information:
  • Protein Domains: (528..80-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (876..100-)
    (/note="Guanylate-cyclase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00099"-)
  • Interpro: IPR001054  IPR018297  IPR001828  IPR001170  IPR011009   IPR029787  IPR028082  IPR000719  IPR001245  
  • Prosite: PS00458 PS00452 PS50125 PS50011
  • DIP: 46246
  • STRING: ENSP00000357669
• Other Databases: GeneCards:  NPR1  Malacards:  NPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016941	natriuretic peptide receptor activity	IBA	molecular function
GO:0001653	peptide receptor activity	IBA	molecular function
GO:0004383	guanylate cyclase activity	IBA	molecular function
GO:0006182	cGMP biosynthetic process	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0007168	receptor guanylyl cyclase signaling pathway	IBA	biological process
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0007168	receptor guanylyl cyclase signaling pathway	IDA	biological process
GO:0004383	guanylate cyclase activity	IDA	molecular function
GO:0016941	natriuretic peptide receptor activity	IDA	molecular function
GO:0016941	natriuretic peptide receptor activity	IDA	molecular function
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0009190	cyclic nucleotide biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016849	phosphorus-oxygen lyase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0006182	cGMP biosynthetic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1903779	regulation of cardiac conduction	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0010753	positive regulation of cGMP-mediated signaling	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0042417	dopamine metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006182	cGMP biosynthetic process	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0035810	positive regulation of urine volume	TAS	biological process
GO:0008528	G protein-coupled peptide receptor activity	NAS	molecular function
GO:0007589	body fluid secretion	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0043114	regulation of vascular permeability	TAS	biological process
GO:0097746	regulation of blood vessel diameter	NAS	biological process
GO:0030308	negative regulation of cell growth	NAS	biological process
GO:0016525	negative regulation of angiogenesis	TAS	biological process
GO:0008217	regulation of blood pressure	NAS	biological process
GO:0042562	hormone binding	IPI	molecular function
GO:0035815	positive regulation of renal sodium excretion	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa00230	Purine metabolism
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa04925	Aldosterone synthesis and secretion
hsa04924	Renin secretion
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Myocardial infarction	PMID:14646971
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray